KEGG   Homo sapiens (human): 91653
Entry
91653             CDS       T01001                                 

Symbol
BOC, Boi, CDON2
Name
(RefSeq) BOC cell adhesion associated, oncogene regulated
  KO
K20020  brother of CDO
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    91653 (BOC)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    91653 (BOC)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig ISET-FN3_linker V-set Ig_4 C2-set_2 Pur_ac_phosph_N Ig_5 C1-set Izumo-Ig Y_Y_Y
Other DBs
NCBI-GeneID: 91653
NCBI-ProteinID: NP_150279
OMIM: 608708
HGNC: 17173
Ensembl: ENSG00000144857
Vega: OTTHUMG00000159305
Pharos: Q9BWV1(Tbio)
UniProt: Q9BWV1
Structure
PDB: 
3N1M 3N1G 3N1P

Position
3q13.2
AA seq 1114 aa
MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVE
PPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPA
TVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIM
PSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPPEAQTI
IVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCM
ADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNA
VPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQD
AELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSS
PRTSKTDSYELVWRPRHEGSGRAPILYYVVKHRKVTNSSDDWTISGIPANQHRLTLTRLD
PGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPDH
GRLSPPEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIP
PSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYITF
TDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHL
QPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPLPETIERP
VGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPPS
CPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGEL
QQQSDTSSLLRQTHLGNGYDPQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDCCQ
RQEQPAAVGQSGVRRAPDSPVLEAVWDPPFHSGPPCCLGLVPVEEVDSPDSCQVSGGDWC
PQHPVGAYVGQEPGMQLSPGPLVRVSFETPPLTI
NT seq 3345 nt   +upstreamnt  +downstreamnt
atgctgcgtgggacgatgacggcgtggagaggaatgaggcctgaggtcacactggcttgc
ctcctcctagccacagcaggctgctttgctgacttgaacgaggtccctcaggtcaccgtc
cagcctgcgtccaccgtccagaagcccggaggcactgtgatcttgggctgcgtggtggaa
cctccaaggatgaatgtaacctggcgcctgaatggaaaggagctgaatggctcggatgat
gctctgggtgtcctcatcacccacgggaccctcgtcatcactgcccttaacaaccacact
gtgggacggtaccagtgtgtggcccggatgcctgcgggggctgtggccagcgtgccagcc
actgtgacactagccaatctccaggacttcaagttagatgtgcagcacgtgattgaagtg
gatgagggaaacacagcagtcattgcctgccacctgcctgagagccaccccaaagcccag
gtccggtacagcgtcaaacaagagtggctggaggcctccagaggtaactacctgatcatg
ccctcagggaacctccagattgtgaatgccagccaggaggacgagggcatgtacaagtgt
gcagcctacaacccagtgacccaggaagtgaaaacctccggctccagcgacaggctacgt
gtgcgccgctccaccgctgaggctgcccgcatcatctaccccccagaggcccaaaccatc
atcgtcaccaaaggccagagtctcattctggagtgtgtggccagtggaatcccaccccca
cgggtcacctgggccaaggatgggtccagtgtcaccggctacaacaagacgcgcttcctg
ctgagcaacctcctcatcgacaccaccagcgaggaggactcaggcacctaccgctgcatg
gccgacaatggggttgggcagcccggggcagcggtcatcctctacaatgtccaggtgttt
gaaccccctgaggtcaccatggagctatcccagctggtcatcccctggggccagagtgcc
aagcttacctgtgaggtgcgtgggaaccccccgccctccgtgctgtggctgaggaatgct
gtgcccctcatctccagccagcgcctccggctctcccgcagggccctgcgcgtgctcagc
atggggcctgaggacgaaggcgtctaccagtgcatggccgagaacgaggttgggagcgcc
catgccgtagtccagctgcggacctccaggccaagcataaccccaaggctatggcaggat
gctgagctggctactggcacacctcctgtatcaccctccaaactcggcaaccctgagcag
atgctgagggggcaaccggcgctccccagacccccaacgtcagtggggcctgcttccccg
cagtgtccaggagagaaggggcagggggctcccgccgaggctcccatcatcctcagctcg
ccccgcacctccaagacagactcatatgaactggtgtggcggcctcggcatgagggcagt
ggccgggcgccaatcctctactatgtggtgaaacaccgcaaggtcacaaattcctctgac
gattggaccatctctggcattccagccaaccagcaccgcctgaccctcaccagacttgac
cccgggagcttgtatgaagtggagatggcagcttacaactgtgcgggagagggccagaca
gccatggtcaccttccgaactggacggcggcccaaacccgagatcatggccagcaaagag
cagcagatccagagagacgaccctggagccagtccccagagcagcagccagccagaccac
ggccgcctctcccccccagaagctcccgacaggcccaccatctccacggcctccgagacc
tcagtgtacgtgacctggattccccgtgggaatggtgggttcccaatccagtccttccgt
gtggagtacaagaagctaaagaaagtgggagactggattctggccaccagcgccatcccc
ccatcgcggctgtccgtggagatcacgggcctagagaaaggcacctcctacaagtttcga
gtccgggctctgaacatgctgggggagagcgagcccagcgccccctctcggccctacgtg
gtgtcgggctacagcggtcgcgtgtacgagaggcccgtggcaggtccttatatcaccttc
acggatgcggtcaatgagaccaccatcatgctcaagtggatgtacatcccagcaagtaac
aacaacaccccaatccatggcttttatatctattatcgacccacagacagtgacaatgat
agtgactacaagaaggatatggtggaaggggacaagtactggcactccatcagccacctg
cagccagagacctcctacgacattaagatgcagtgcttcaatgaaggaggggagagcgag
ttcagcaacgtgatgatctgtgagaccaaagctcggaagtcttctggccagcctggtcga
ctgccacccccaactctggccccaccacagccgccccttcctgaaaccatagagcggccg
gtgggcactggggccatggtggctcgctccagcgacctgccctatctgattgtcggggtc
gtcctgggctccatcgttctcatcatcgtcaccttcatccccttctgcttgtggagggcc
tggtctaagcaaaaacatacaacagacctgggttttcctcgaagtgcccttccaccctcc
tgcccgtatactatggtgccattgggaggactcccaggccaccaggccagtggacagccc
tacctcagtggcatcagtggacgggcctgtgctaatgggatccacatgaataggggctgc
ccctcggctgcagtgggctacccgggcatgaagccccagcagcactgcccaggcgagctt
cagcagcagagtgacaccagcagcctgctgaggcagacccatcttggcaatggatatgac
ccccaaagtcaccagatcacgaggggtcccaagtctagcccggacgagggctctttctta
tacacactgcccgacgactccactcaccagctgctgcagccccatcacgactgctgccaa
cgccaggagcagcctgctgctgtgggccagtcaggggtgaggagagcccccgacagtcct
gtcctggaagcagtgtgggaccctccatttcactcagggcccccatgctgcttgggcctt
gtgccagttgaagaggtggacagtcctgactcctgccaagtgagtggaggagactggtgt
ccccagcaccccgtaggggcctacgtaggacaggaacctggaatgcagctctccccgggg
ccactggtgcgtgtgtcttttgaaacaccacctctcacaatttag

DBGET integrated database retrieval system