KEGG   Homo sapiens (human): 91662Help
Entry
91662             CDS       T01001                                 

Gene name
NLRP12, CLR19.3, FCAS2, NALP12, PAN6, PYPAF7, RNO, RNO2
Definition
(RefSeq) NLR family pyrin domain containing 12
  KO
K20865  NACHT, LRR and PYD domains-containing protein 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    91662 (NLRP12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    91662 (NLRP12)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   91662 (NLRP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN LRR_6 FISNA LRR_4 NB-ARC AAA_25 AAA_16
Motif
Other DBs
NCBI-GeneID: 91662
NCBI-ProteinID: NP_653288
OMIM: 609648
HGNC: 22938
Ensembl: ENSG00000142405
Vega: OTTHUMG00000060776
Pharos: P59046(Tbio)
UniProt: P59046
Structure
PDB: 

Position
19q13.42
AA seq 1061 aa AA seqDB search
MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEKAGPLEMAQLL
ITHFGPEEAWRLALSTFERINRKDLWERGQREDLVRDTPPGGPSSLGNQSTCLLEVSLVT
PRKDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLVKEHSNPMQVQQQLLDTG
RGHARTVGHQASPIKIETLFEPDEERPEPPRTVVMQGAAGIGKSMLAHKVMLDWADGKLF
QGRFDYLFYINCREMNQSATECSMQDLIFSCWPEPSAPLQELIRVPERLLFIIDGFDELK
PSFHDPQGPWCLCWEEKRPTELLLNSLIRKKLLPELSLLITTRPTALEKLHRLLEHPRHV
EILGFSEAERKEYFYKYFHNAEQAGQVFNYVRDNEPLFTMCFVPLVCWVVCTCLQQQLEG
GGLLRQTSRTTTAVYMLYLLSLMQPKPGAPRLQPPPNQRGLCSLAADGLWNQKILFEEQD
LRKHGLDGEDVSAFLNMNIFQKDINCERYYSFIHLSFQEFFAAMYYILDEGEGGAGPDQD
VTRLLTEYAFSERSFLALTSRFLFGLLNEETRSHLEKSLCWKVSPHIKMDLLQWIQSKAQ
SDGSTLQQGSLEFFSCLYEIQEEEFIQQALSHFQVIVVSNIASKMEHMVSSFCLKRCRSA
QVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSL
YRNALGSRGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIANKNLTRMDLSGN
GVGFPGMMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNPHLVELDLTGNALE
DLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLG
VLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWL
LAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCK
RLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgctacgaaccgcaggcagggacggcctctgtcgcctgtccacctacttggaagaactc
gaggctgtggaactgaagaagttcaagttatacctggggaccgcgacagagctgggagaa
ggcaagatcccctggggaagcatggagaaggccggtcccctggaaatggcccagctgctc
atcacccacttcgggccagaggaggcctggaggttggctctcagcacctttgagcggata
aacaggaaggacctgtgggagagaggacagagagaggacctggtgagggataccccacct
ggtggcccgtcctcacttgggaaccagtcaacatgccttctggaagtctctcttgtcact
ccaagaaaagatccccaggaaacctacagggactatgtccgcaggaaattccggctcatg
gaagaccgcaatgcgcgcctaggggaatgtgtcaacctcagccaccggtacacccggctc
ctgctggtgaaggagcactcaaaccccatgcaggtccagcagcagcttctggacacaggc
cggggacacgcgaggaccgtgggacaccaggctagccccatcaagatagagaccctcttt
gagccagacgaggagcgccccgagccaccgcgcaccgtggtcatgcaaggcgcggcaggg
ataggcaagtccatgctggcacacaaggtgatgctggactgggcggacgggaagctcttc
caaggcagatttgattatctcttctacatcaactgcagggagatgaaccagagtgccacg
gaatgcagcatgcaagacctcatcttcagctgctggcctgagcccagcgcgcctctccag
gagctcatccgagttcccgagcgcctccttttcatcatcgacggcttcgatgagctcaag
ccttctttccacgatcctcagggaccctggtgcctctgctgggaggagaaacggcccacg
gagctgcttcttaacagcttaattcggaagaagctgctccctgagctatctttgctcatc
accacacggcccacggctttggagaagctccaccgtctgctggagcaccccaggcatgtg
gagatcctgggcttctctgaggcagaaaggaaggaatacttctacaagtatttccacaat
gcagagcaggcgggccaagtcttcaattacgtgagggacaacgagcctctcttcaccatg
tgcttcgtccccctggtgtgctgggtggtgtgtacctgcctccagcagcagctggagggt
ggggggctgttgagacagacgtccaggaccaccactgcagtgtacatgctctacctgctg
agtctgatgcaacccaagccgggggccccgcgcctccagcccccacccaaccagagaggg
ttgtgctccttggcggcagatgggctctggaatcagaaaatcctatttgaggagcaggac
ctccggaagcacggcctagacggggaagacgtctctgccttcctcaacatgaacatcttc
cagaaggacatcaactgtgagaggtactacagcttcatccacttgagtttccaggaattc
tttgcagctatgtactatatcctggacgagggggagggcggggcaggcccagaccaggac
gtgaccaggctgttgaccgagtacgcgttttctgaaaggagcttcctggcactcaccagc
cgcttcctgtttggactcctgaacgaggagaccaggagccacctggagaagagtctctgc
tggaaggtctcgccgcacatcaagatggacctgttgcagtggatccaaagcaaagctcag
agcgacggctccaccctgcagcagggctccttggagttcttcagctgcttgtacgagatc
caggaggaggagtttatccagcaggccctgagccacttccaggtgatcgtggtcagcaac
attgcctccaagatggagcacatggtctcctcgttctgtctgaagcgctgcaggagcgcc
caggtgctgcacttgtatggcgccacctacagcgcggacggggaagaccgcgcgaggtgc
tccgcaggagcgcacacgctgttggtgcagctaccagagaggaccgttctgctggacgcc
tacagtgaacatctggcagcggccctgtgcaccaatccaaacctgatagagctgtctctg
taccgaaatgccctgggcagccggggggtgaagctgctctgtcaaggactcagacacccc
aactgcaaacttcagaacctgaggctgaagaggtgccgcatctccagctcagcctgcgag
gacctctctgcagctctcatagccaataagaatttgacaaggatggatctcagtggcaac
ggcgttggattcccaggcatgatgctgctttgcgagggcctgcggcatccccaatgcagg
ctgcagatgattcagttgaggaagtgtcagctggagtccggggcttgtcaggagatggct
tctgtgctcggcaccaacccacatctggttgagttggacctgacaggaaatgcactggag
gatttgggcctgaggttactatgccagggactgaggcacccagtctgcagactacggact
ttgtggctgaagatctgccgcctcactgctgctgcctgtgacgagctggcctcaactctc
agtgtgaaccagagcctgagagagctggacctgagcctgaatgagctgggggacctcggg
gtgctgctgctgtgtgagggcctcaggcatcccacgtgcaagctccagaccctgcggttg
ggcatctgccggctgggctctgccgcctgtgagggtctttctgtggtgctccaggccaac
cacaacctccgggagctggacttgagtttcaacgacctgggagactggggcctgtggttg
ctggctgaggggctgcaacatcccgcctgcagactccagaaactgtggctggatagctgt
ggcctcacagccaaggcttgtgagaatctttacttcaccctggggatcaaccagaccttg
accgacctttacctgaccaacaacgccctaggggacacaggtgtccgactgctttgcaag
cggctgagccatcctggctgcaaactccgagtcctctggttatttgggatggacctgaat
aaaatgacccacagtaggttggcagcgcttcgagtaacaaaaccttatttggacattggc
tgctga

DBGET integrated database retrieval system