KEGG   Homo sapiens (human): 91663
Entry
91663             CDS       T01001                                 

Gene name
MYADM, SB135
Definition
(RefSeq) myeloid associated differentiation marker
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MARVEL
Other DBs
NCBI-GeneID: 91663
NCBI-ProteinID: NP_001018654
OMIM: 609959
HGNC: 7544
Ensembl: ENSG00000179820
Vega: OTTHUMG00000060775
Pharos: Q96S97(Tbio)
UniProt: Q96S97 A0A024R4N0
Position
19q13.42
AA seq 322 aa
MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAW
TGSMGNWSMFTWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIY
PTTYVQFLSHGRSRDHAIAATFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLE
TFVACIIFAFISDPNLYQHQPALEWCVAVYAICFILAAIAILLNLGECTNVLPIPFPSFL
SGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCSRSHAYYVCAWDRRLAVAILT
AINLLAYVADLVHSAHLVFVKV
NT seq 969 nt   +upstreamnt  +downstreamnt
atgccagtgacggtaacccgcaccaccatcacaaccaccacgacgtcatcttcgggcctg
gggtcccccatgatcgtggggtcccctcgggccctgacacagcccctgggtctccttcgc
ctgctgcagctggtgtctacctgcgtggccttctcgctggtggctagcgtgggcgcctgg
acggggtccatgggcaactggtccatgttcacctggtgcttctgcttctccgtgaccctg
atcatcctcatcgtggagctgtgcgggctccaggcccgcttccccctgtcttggcgcaac
ttccccatcaccttcgcctgctatgcggccctcttctgcctctcggcctccatcatctac
cccaccacctatgtccagttcctgtcccacggccgttcgcgggaccacgccatcgccgcc
accttcttctcctgcatcgcgtgtgtggcttacgccaccgaagtggcctggacccgggcc
cggcccggcgagatcactggctatatggccaccgtacccgggctgctgaaggtgctggag
accttcgttgcctgcatcatcttcgcgttcatcagcgaccccaacctgtaccagcaccag
ccggccctggagtggtgcgtggcggtgtacgccatctgcttcatcctagcggccatcgcc
atcctgctgaacctgggggagtgcaccaacgtgctacccatccccttccccagcttcctg
tcggggctggccttgctgtctgtcctcctctatgccaccgcccttgttctctggcccctc
taccagttcgatgagaagtatggcggccagcctcggcgctcgagagatgtaagctgcagc
cgcagccatgcctactacgtgtgtgcctgggaccgccgactggctgtggccatcctgacg
gccatcaacctactggcgtatgtggctgacctggtgcactctgcccacctggtttttgtc
aaggtctaa

DBGET integrated database retrieval system