KEGG   Homo sapiens (human): 9167Help
Entry
9167              CDS       T01001                                 

Gene name
COX7A2L, COX7AR, COX7RP, EB1, SIG81
Definition
(RefSeq) cytochrome c oxidase subunit 7A2 like
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    9167 (COX7A2L)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    9167 (COX7A2L)
  09159 Environmental adaptation
   04714 Thermogenesis
    9167 (COX7A2L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9167 (COX7A2L)
   05012 Parkinson disease
    9167 (COX7A2L)
   05016 Huntington disease
    9167 (COX7A2L)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9167 (COX7A2L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7a
Motif
Other DBs
NCBI-GeneID: 9167
NCBI-ProteinID: NP_001305965
OMIM: 605771
HGNC: 2289
Ensembl: ENSG00000115944
Vega: OTTHUMG00000128605
Pharos: O14548(Tdark)
UniProt: O14548 Q6FGA0 D6W5A1
Position
2p21
AA seq 114 aa AA seqDB search
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKV
PELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtactacaagtttagtggcttcacgcagaagttggcaggagcatgggcttcggaggcc
tatagcccgcagggattaaagcctgtggtttccacagaagcaccacctatcatatttgcc
acaccaactaaactgacctccgattccacagtgtatgattatgctgggaaaaacaaagtt
ccagagctacaaaagtttttccagaaagctgatggtgtgcccgtctacctgaaacgaggc
ctgcctgaccaaatgctttaccggaccaccatggcgctgactgtgggagggaccatctac
tgcctgatcgccctctacatggcttcgcagcccaaaaacaaatga

DBGET integrated database retrieval system