KEGG   Homo sapiens (human): 9170Help
Entry
9170              CDS       T01001                                 

Gene name
LPAR2, EDG-4, EDG4, LPA-2, LPA2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9170 (LPAR2)
   04072 Phospholipase D signaling pathway
    9170 (LPAR2)
   04151 PI3K-Akt signaling pathway
    9170 (LPAR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9170 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9170 (LPAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9170 (LPAR2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9170 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9170 (LPAR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    9170 (LPAR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt
Motif
Other DBs
NCBI-GeneID: 9170
NCBI-ProteinID: NP_004711
OMIM: 605110
HGNC: 3168
Ensembl: ENSG00000064547
Vega: OTTHUMG00000182328
Pharos: Q9HBW0(Tchem)
UniProt: Q9HBW0 A0A024R7M9
Position
19p13.11
AA seq 351 aa AA seqDB search
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcatgggccagtgctactacaacgagaccatcggcttcttctataacaacagt
ggcaaagagctcagctcccactggcggcccaaggatgtggtcgtggtggcactggggctg
accgtcagcgtgctggtgctgctgaccaatctgctggtcatagcagccatcgcctccaac
cgccgcttccaccagcccatctactacctgctcggcaatctggccgcggctgacctcttc
gcgggcgtggcctacctcttcctcatgttccacactggtccccgcacagcccgactttca
cttgagggctggttcctgcggcagggcttgctggacacaagcctcactgcgtcggtggcc
acactgctggccatcgccgtggagcggcaccgcagtgtgatggccgtgcagctgcacagc
cgcctgccccgtggccgcgtggtcatgctcattgtgggcgtgtgggtggctgccctgggc
ctggggctgctgcctgcccactcctggcactgcctctgtgccctggaccgctgctcacgc
atggcacccctgctcagccgctcctatttggccgtctgggctctgtcgagcctgcttgtc
ttcctgctcatggtggctgtgtacacccgcattttcttctacgtgcggcggcgagtgcag
cgcatggcagagcatgtcagctgccacccccgctaccgagagaccacgctcagcctggtc
aagactgttgtcatcatcctgggggcgttcgtggtctgctggacaccaggccaggtggta
ctgctcctggatggtttaggctgtgagtcctgcaatgtcctggctgtagaaaagtacttc
ctactgttggccgaggccaactcactggtcaatgctgctgtgtactcttgccgagatgct
gagatgcgccgcaccttccgccgccttctctgctgcgcgtgcctccgccagtccacccgc
gagtctgtccactatacatcctctgcccagggaggtgccagcactcgcatcatgcttccc
gagaacggccacccactgatggactccaccctttag

DBGET integrated database retrieval system