KEGG   Homo sapiens (human): 91703Help
Entry
91703             CDS       T01001                                 

Gene name
ACY3, ACY-3, HCBP1
Definition
(RefSeq) aminoacylase 3
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    91703 (ACY3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     91703 (ACY3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AstE_AspA
Motif
Other DBs
NCBI-GeneID: 91703
NCBI-ProteinID: NP_542389
OMIM: 614413
HGNC: 24104
Ensembl: ENSG00000132744
Vega: OTTHUMG00000167283
Pharos: Q96HD9(Tbio)
UniProt: Q96HD9 A0A024R5L2
Position
11q13.2
AA seq 319 aa AA seqDB search
MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSG
CRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTA
NMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELG
PQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLA
GTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYPVFINEAAYYEKGVAFVQTEK
FTFTVPAMPALTPAPSPAS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcactgcctgtgccccgggagcccctgcgtcgcgtggctgtgactgggggcacg
catggcaacgagatgtcgggcgtctacctggcccggcactggctgcatgcccccgcagag
ctgcagagagccagcttctccgctgtgcctgtgctggccaacccggcagccacatccggc
tgccgccgctacgtggaccatgacctcaaccgcaccttcaccagcagcttcctcaattcc
aggcccaccccggacgacccatatgaggtgacaagagcccgagagctgaaccagctgctg
gggcccaaggcctcgggccaggcctttgactttgtccttgacctgcacaacaccacggcc
aacatgggcacctgcttaatcgcgaagtcctcccacgaagtctttgccatgcacctgtgc
cgccatctgcagctgcagtaccccgagctgtcctgccaggtcttcctgtaccagcggtct
ggggaggagagctacaacctggactctgtggccaaaaatggactgggtctggagctgggc
ccccagccacagggtgtgctgcgggctgacattttctcaaggatgaggaccctggtggcc
acagttctggacttcatcgaactcttcaaccagggtacggcctttcctgcctttgagatg
gaagcctatagacccgtgggcgtcgtggacttcccccgcaccgaggccgggcacctggca
ggcactgtgcatcctcagctgcaggaccgagacttccagccactgcagcctggtgctccc
atcttccagatgttcagtggggaggacctgctctatgagggagagtccacggtgtacccc
gtgttcattaacgaggctgcctactatgagaagggcgttgcctttgtccagactgagaag
ttcacattcaccgtgcctgccatgcccgcgctgacccctgccccgagcccagcttcctaa

DBGET integrated database retrieval system