KEGG   Homo sapiens (human): 9173Help
Entry
9173              CDS       T01001                                 

Gene name
IL1RL1, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Definition
(RefSeq) interleukin 1 receptor like 1
  KO
K05171  interleukin 1 receptor-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9173 (IL1RL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    9173 (IL1RL1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   9173 (IL1RL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_3 I-set ig Ig_2 Ig_6 V-set TIR_2
Motif
Other DBs
NCBI-GeneID: 9173
NCBI-ProteinID: NP_057316
OMIM: 601203
HGNC: 5998
Ensembl: ENSG00000115602
Vega: OTTHUMG00000130782
Pharos: Q01638(Tbio)
UniProt: Q01638
Structure
PDB: 

Position
2q12.1
AA seq 556 aa AA seqDB search
MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYS
TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG
KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLL
WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
EMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK
IPRKASSLTPLAAQKQ
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggggttttggatcttagcaattctcacaattctcatgtattccacagcagcaaagttt
agtaaacaatcatggggcctggaaaatgaggctttaattgtaagatgtcctagacaagga
aaacctagttacaccgtggattggtattactcacaaacaaacaaaagtattcccactcag
gaaagaaatcgtgtgtttgcctcaggccaacttctgaagtttctaccagctgcagttgct
gattctggtatttatacctgtattgtcagaagtcccacattcaataggactggatatgcg
aatgtcaccatatataaaaaacaatcagattgcaatgttccagattatttgatgtattca
acagtatctggatcagaaaaaaattccaaaatttattgtcctaccattgacctctacaac
tggacagcacctcttgagtggtttaagaattgtcaggctcttcaaggatcaaggtacagg
gcgcacaagtcatttttggtcattgataatgtgatgactgaggacgcaggtgattacacc
tgtaaatttatacacaatgaaaatggagccaattatagtgtgacggcgaccaggtccttc
acggtcaaggatgagcaaggcttttctctgtttccagtaatcggagcccctgcacaaaat
gaaataaaggaagtggaaattggaaaaaacgcaaacctaacttgctctgcttgttttgga
aaaggcactcagttcttggctgccgtcctgtggcagcttaatggaacaaaaattacagac
tttggtgaaccaagaattcaacaagaggaagggcaaaatcaaagtttcagcaatgggctg
gcttgtctagacatggttttaagaatagctgacgtgaaggaagaggatttattgctgcag
tacgactgtctggccctgaatttgcatggcttgagaaggcacaccgtaagactaagtagg
aaaaatccaattgatcatcatagcatctactgcataattgcagtatgtagtgtattttta
atgctaatcaatgtcctggttatcatcctaaaaatgttctggattgaggccactctgctc
tggagagacatagctaaaccttacaagactaggaatgatggaaagctctatgatgcttat
gttgtctacccacggaactacaaatccagtacagatggggccagtcgtgtagagcacttt
gttcaccagattctgcctgatgttcttgaaaataaatgtggctataccttatgcatttat
gggagagatatgctacctggagaagatgtagtcactgcagtggaaaccaacatacgaaag
agcaggcggcacattttcatcctgacccctcagatcactcacaataaggagtttgcctac
gagcaggaggttgccctgcactgtgccctcatccagaacgacgccaaggtgatacttatt
gagatggaggctctgagcgagctggacatgctgcaggctgaggcgcttcaggactccctc
cagcatcttatgaaagtacaggggaccatcaagtggagggaggaccacattgccaataaa
aggtccctgaattctaaattctggaagcacgtgaggtaccaaatgcctgtgccaagcaaa
attcccagaaaggcctctagtttgactcccttggctgcccagaagcaatag

DBGET integrated database retrieval system