KEGG   Homo sapiens (human): 9175Help
Entry
9175              CDS       T01001                                 

Gene name
MAP3K13, LZK, MEKK13, MLK
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 13
  KO
K04422  mitogen-activated protein kinase kinase kinase 13 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    9175 (MAP3K13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     9175 (MAP3K13)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   9175 (MAP3K13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase DUF737
Motif
Other DBs
NCBI-GeneID: 9175
NCBI-ProteinID: NP_001229243
OMIM: 604915
HGNC: 6852
Ensembl: ENSG00000073803
Vega: OTTHUMG00000156673
Pharos: O43283(Tbio)
UniProt: O43283
Position
3q27.2
AA seq 966 aa AA seqDB search
MANFQEHLSCSSSPHLPFSESKTFNGLQDELTAMGNHPSPKLLEDQQEKGMVRTELIESV
HSPVTTTVLTSVSEDSRDQFENSVLQLREHDESETAVSQGNSNTVDGESTSGTEDIKIQF
SRSGSGSGGFLEGLFGCLRPVWNIIGKAYSTDYKLQQQDTWEVPFEEISELQWLGSGAQG
AVFLGKFRAEEVAIKKVREQNETDIKHLRKLKHPNIIAFKGVCTQAPCYCIIMEYCAHGQ
LYEVLRAGRKITPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHTDAVKISDFGT
SKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSA
IIWGVGSNSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQTLMHLDIASADVLATPQE
TYFKSQAEWREEVKKHFEKIKSEGTCIHRLDEELIRRRREELRHALDIREHYERKLERAN
NLYMELSAIMLQLEMREKELIKREQAVEKKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPH
KSGMQTKRPDLLRSEGIPTTEVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHS
DFAAILKNQPAQENSPHPTYLHQAQSQYPSLHHHNSLQQQYQQPPPAMSQSHHPRLNMHG
QDIATCANNLRYFGPAAALRSPLSNHAQRQLPGSSPDLISTAMAADCWRSSEPDKGQAGP
WGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENE
FSGCRSESSLGTSHLGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCIS
SCQSYSTFSSENFSVSDGEEGNTSDHSNSPDELADKLEDRLAEKLDDLLSQTPEIPIDIS
SHSDGLSDKECAVRRVKTQMSLGKLCVEERGYENPMQFEESDCDSSDGECSDATVRTNKH
YSSATW
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggccaactttcaggagcacctgagctgctcctcttctccacacttacccttcagtgaa
agcaaaaccttcaatggactacaagatgagctcacagctatggggaaccacccttctccc
aagctgctcgaggaccagcaggaaaaggggatggtacgaacagagctaatcgagagcgtg
cacagccccgtcaccacaacagtgttgacgagcgtaagtgaggattccagggaccagttt
gagaacagcgttcttcagctaagggaacacgatgaatcagagacggcggtgtctcagggg
aacagcaacacggtggacggagagagcacaagcggaactgaagacataaagattcagttc
agcaggtcaggcagtggcagtggtgggtttcttgaaggactatttggatgcttaaggcct
gtatggaatatcattgggaaggcatattccactgattacaaattgcagcagcaagatact
tgggaagtgccatttgaggagatctcagagctgcagtggctgggtagtggagcccaagga
gcggtcttcttgggcaagttccgggcggaagaggtggccatcaagaaagtgagagaacag
aatgagacggatatcaagcatttgaggaagttgaagcaccctaacatcatcgcattcaag
ggtgtttgtactcaggccccatgttattgtattatcatggaatactgtgcccatggacaa
ctctacgaggtcttacgagctggcaggaagatcacacctcgattgctagtagactggtcc
acaggaattgcaagtggaatgaattatttgcacctccataaaattattcatcgtgatctc
aaatcacctaatgttttagtgacccacacagatgcggtaaaaatttcagattttggtaca
tctaaggaactcagtgacaaaagtaccaagatgtcatttgctggcacggtcgcatggatg
gcgccagaggtgatacggaatgaacctgtctctgaaaaagttgatatatggtcttttgga
gtggtgctttgggagctgctgacaggagagatcccttacaaagatgtagattcttcagcc
attatctggggtgttggaagcaacagcctccaccttccagttccttccacttgccctgat
ggattcaaaatccttatgaaacagacgtggcagagtaaacctcgaaaccgaccttctttt
cggcagacactcatgcatttagacattgcctctgcagatgtacttgccaccccacaagaa
acttacttcaagtctcaggctgaatggagagaagaagtgaaaaaacattttgagaagatc
aaaagtgaaggaacttgtatacaccggttagatgaagaactgattcgaaggcgcagagaa
gagctcaggcatgcgctggatattcgtgaacactatgagcggaagcttgagcgggcgaat
aatttatacatggaattgagtgccatcatgctgcagctagaaatgcgggagaaggagctc
attaagcgtgagcaagcagtggaaaagaagtatcctgggacctacaaacgacaccctgtt
cgtcctatcatccatcccaatgccatggagaaactcatgaaaaggaaaggagtgcctcac
aaatctgggatgcagaccaaacggccagacttgttgagatcagaagggatccccaccaca
gaagtggctcccactgcatcccctttgtccggaagtcccaaaatgtccacttctagcagc
aagagccgatatcgaagcaaaccacgccaccgccgagggaatagcagaggcagccatagt
gactttgccgcaatcttgaaaaaccagccagcccaggaaaattcaccccatcccacttac
ctgcaccaagctcaatcccaatacccttctcttcatcaccataattctctgcagcagcaa
taccagcagccccctcctgccatgtcccagagtcaccatcccagactcaatatgcacgga
caggacatagcaacctgcgccaacaacctgaggtatttcggcccagcagcagccctgcgg
agcccactcagcaaccatgctcagagacagctgcccggctcgagccctgacctcatctcc
acagccatggctgcagactgctggagaagttctgagcctgacaagggccaagctggtccc
tggggctgttgccaggctgacgcttatgacccctgccttcagtgcaggccagaacagtat
gggtccttagacataccctctgctgagccagtggggaggagccctgacctttccaagtca
ccagcacataatcctctcttggaaaacgcccagagttctgagaaaacggaagaaaatgaa
ttcagcggctgtaggtctgagtcatccctcggcacctctcatctcggcacccctccagcg
ctacctcgaaaaacaaggcctctgcagaagagtggagatgactcctcagaagaggaagaa
ggggaagtagatagtgaagttgaatttccacgaagacagaggccccatcgctgtatcagc
agctgccagtcatattcaacctttagctctgagaatttctctgtgtctgatggagaagag
ggaaataccagtgaccactcaaacagtcctgatgagttagctgataaacttgaagaccgc
ttggcagagaagctagacgacctgctgtcccagacgccagagattcccattgacatatcc
tcacactcggatgggctctctgacaaggagtgtgccgtgcgccgtgtgaagactcagatg
tctctgggcaagctgtgtgtggaggaacgtggctatgagaaccccatgcagtttgaagaa
tcggactgtgactcttcagatggggagtgttctgatgccacagttaggaccaataaacac
tacagctctgctacctggtaa

DBGET integrated database retrieval system