KEGG   Homo sapiens (human): 91768Help
Entry
91768             CDS       T01001                                 

Gene name
CABLES1, CABL1, CABLES, HsT2563, IK3-1
Definition
(RefSeq) Cdk5 and Abl enzyme substrate 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 91768
NCBI-ProteinID: NP_001094089
OMIM: 609194
HGNC: 25097
Ensembl: ENSG00000134508
Vega: OTTHUMG00000179186
Pharos: Q8TDN4(Tbio)
UniProt: Q8TDN4 A7K6Y5
Position
18q11.2
AA seq 633 aa AA seqDB search
MAAAAAAATTAACSSGSAGTDAAGASGLQQPPPQPQPQPAAAAPAQPPPEPPRKPRMDPR
RRQAALSFLTNISLDGRLPPQDAEWGGGEEGGAAKPGAGGACGARTRFSLLAAAERGGCI
ALAAPGTPAAGLAAGSGPCLPQPSSLPPLIPGGHATVSGPGVARGFASPLGAGRASGEQW
QPPRPAPLAACAQLQLLDGSGAAGQEELEEDDAFISVQVPAAAFLGSGTPGSGSGSRGRL
NSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEE
NAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDST
QVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTS
SFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPS
YMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAM
AFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRREL
IAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggccgccaccacggccgcctgcagcagcggcagcgccggcacc
gacgccgcgggcgccagcggattgcagcagccgccgccgcagccccagcctcagcccgcg
gccgccgcgccggcccagccgccgcccgaacccccccggaagccgcgcatggacccgcgg
cgccgccaggctgccctctccttcctcaccaacatctcgctggacggccggctgccgccg
caggacgcggagtggggcggtggcgaggagggcggcgcggccaagccgggcgccggcggc
gcctgcggcgcgaggactcggttcagcttgctcgccgctgccgagcggggcggctgcatc
gcgctcgccgcgccgggcacgccggctgcggggttagccgctgggtccggcccctgcctc
ccacagccctcgtcgctgccgcccttgattcctggcggccatgcgaccgtgtccggcccc
ggggtggcgcgggggttcgcgagtcccctgggcgccggccgggcgtcgggggagcagtgg
cagccgccccggccggcgcctctcgccgcctgtgcccaactgcagctgctcgacgggtcc
ggggccgccgggcaggaggagttggaggaggacgatgcctttatcagcgtgcaggtgccg
gcggccgcctttttgggctccgggacccccgggagtgggagcggcagtcggggacgcctc
aactcgttcactcagggaatcctgcccatcgccttctccaggccgacttcgcagaactac
tgctccctggagcagccaggccagggcggcagcaccagcgccttcgagcagctgcagagg
tcccgacggcgcctcatctcccagagatcttccttggagaccctggaagatattgaggag
aacgcccctctccggagatgtcgaactctctcaggttcacccagaccaaagaattttaag
aagattcattttatcaagaacatgcggcaacacgataccaggaatggcagaatagtcctt
atcagtggcagaagatccttctgtagtatattttcagtgctgccgtatcgcgacagtacc
caagtcggggacttgaagttggacggaggaagacaatcaactggtgcagtgagtttgaaa
gagatcattggtctggaaggtgtggagctgggtgctgatgggaagactgtttcctatacc
caatttctgttacccacaaatgcctttggagcccggagaaataccatagactccacctcc
tctttctcccagttccgtaacctgagccaccgcagcctctccataggccgggcaagcggc
acccaggggagcctcgacacaggtagtgacctgggagactttatggactatgacccaaat
ctcttggatgacccccagtggccttgtggcaaacacaaacgcgttctgatcttcccttcc
tacatgacaacagtgattgactacgtgaagccctcggatctcaagaaggacatgaacgag
accttcaaggagaagtttcctcacattaagctgacactcagcaaaattaggagtctgaaa
cgagagatgcggaagcttgcgcaggaggactgtggccttgaggagcccacggtggccatg
gccttcgtctactttgaaaagctcgccctcaaggggaaactcaacaaacagaaccggaag
ctgtgtgctggggcatgtgtgctgttagcagccaaaattggaagtgacctcaaaaaacac
gaagtcaagcatttaattgacaaactggaagagaagttccggctgaacaggcgagaactg
attgcctttgaattcccggtgttagtggccttggaattcgccctccacttgcccgagcac
gaagtcatgccccactacagacggctggtccagagttcctag

DBGET integrated database retrieval system