KEGG   Homo sapiens (human): 9177Help
Entry
9177              CDS       T01001                                 

Gene name
HTR3B, 5-HT3B
Definition
(RefSeq) 5-hydroxytryptamine receptor 3B
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829 D07129
Azasetron (DG01521): D01613 D07481
Batanopride hydrochloride: D03060
Bemesetron: D03073
Cilansetron (DG00047): D03495 D03496
Clozapine: D00283
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725 D07867
Fabesetron hydrochloride: D01838
Galdansetron hydrochloride: D04294
Granisetron (DG00061): D00677 D04370
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Lurosetron mesylate: D04821
Mirisetron maleate: D05050
Mirtazapine (DG02838): D00563 D11056
Ondansetron (DG00060): D00456 D00678
Palonosetron (DG00064): D05343 D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016 D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185
Zacopride hydrochloride: D06353
Zatosetron maleate: D06358
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    9177 (HTR3B)
  09157 Sensory system
   04742 Taste transduction
    9177 (HTR3B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    9177 (HTR3B)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   9177 (HTR3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 9177
NCBI-ProteinID: NP_006019
OMIM: 604654
HGNC: 5298
Ensembl: ENSG00000149305
Vega: OTTHUMG00000168210
Pharos: O95264(Tchem)
UniProt: O95264
Position
11q23.2
AA seq 441 aa AA seqDB search
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVY
LDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIII
NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTV
EDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL
VYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP
LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRA
VVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY
LFMLGIYTITLCSLWALWGGV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagtgtaatggctcccctgtgggcctgcatcctggtggctgcaggaattcta
gccacagatacacatcatccccaggattctgctctgtatcatctcagcaagcagctatta
cagaaatatcataaagaagtgagacctgtttacaactggaccaaggccaccacagtctac
ctggacctgttcgtccatgctatattggatgtggatgcagagaatcaaatattaaagaca
agtgtatggtaccaagaggtctggaatgatgaatttttatcctggaactccagcatgttt
gatgagattagagagatctccctacctctaagtgccatctgggcccccgatatcatcatc
aatgagtttgtggacattgaaagataccctgaccttccctatgtttatgtgaactcatct
gggaccattgagaactataagcccatccaggtggtctctgcgtgcagtttagagacatat
gcttttccatttgatgtccagaattgcagcctgaccttcaagagcattctgcatacagtg
gaagacgtagacctggcctttctgaggagcccagaagacattcagcatgacaaaaaggcg
tttttgaatgacagtgagtgggaacttctatctgtgtcctccacatacagcatcctgcag
agcagcgctggaggatttgcacagattcagtttaatgtggtgatgcgcaggcaccccctg
gtctatgtcgtgagtctgctgattcctagcatctttctcatgctggtggacctggggagc
ttctacctgccacccaactgccgagccaggattgtgttcaagaccagtgtgctggtgggc
tacaccgtcttcagggtcaacatgtccaaccaggtgccacggagtgtagggagcacccct
ctgattgggcacttcttcaccatctgcatggccttcttggttctcagcttagctaagtcc
atcgtgttggtcaaattcctccatgatgagcagcgtggtggacaggagcagcccttcttg
tgccttcgaggggacaccgatgctgacaggcctagagtggaacccagggcccaacgtgct
gtggtaacagagtcctcgctgtatggagagcacctggcccagccaggaaccctgaaggaa
gtctggtcgcagcttcaatctatcagcaactacctccaaactcaggaccagacagaccaa
caggaggcagagtggctggtcctcctgtcccgctttgaccgactgctcttccaaagctac
cttttcatgctggggatctacaccatcactctgtgctccctctgggcactgtggggcggc
gtgtga

DBGET integrated database retrieval system