KEGG   Homo sapiens (human): 9180Help
Entry
9180              CDS       T01001                                 

Gene name
OSMR, IL-31R-beta, IL-31RB, OSMRB, PLCA1
Definition
(RefSeq) oncostatin M receptor
  KO
K05057  oncostatin M receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
Disease
H01217  Primary localized cutaneous amyloidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    9180 (OSMR)
   04151 PI3K-Akt signaling pathway
    9180 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9180 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    9180 (OSMR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   9180 (OSMR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 9180
NCBI-ProteinID: NP_001310434
OMIM: 601743
HGNC: 8507
Ensembl: ENSG00000145623
Vega: OTTHUMG00000090811
Pharos: Q99650(Tbio)
UniProt: Q99650
Position
5p13.1
AA seq 979 aa AA seqDB search
MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDD
AKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP
KDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSIRN
NFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSG
QNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSS
SELHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTE
GGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFR
IYGLSTKRIACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGY
HVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTSA
GEGPSATFTKVTTPDEHSSMLIHILLPMVFCVLLIMVMCYLKSQWIKETCYPDIPDPYKS
SILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYL
LPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKN
YMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPP
TENSSLSSITLLDPGEHYC
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggctctatttgcagtctttcagacaacattcttcttaacattgctgtccttgaggact
taccagagtgaagtcttggctgaacgtttaccattgactcctgtatcacttaaagtttcc
accaattctacgcgtcagagtttgcacttacaatggactgtccacaaccttccttatcat
caggaattgaaaatggtatttcagatccagatcagtaggattgaaacatccaatgtcatc
tgggtggggaattacagcaccactgtgaagtggaaccaggttctgcattggagctgggaa
tctgagctccctttggaatgtgccacacactttgtaagaataaagagtttggtggacgat
gccaagttccctgagccaaatttctggagcaactggagttcctgggaggaagtcagtgta
caagattctactggacaggatatattgttcgttttccctaaagataagctggtggaagaa
ggcaccaatgttaccatttgttacgtttctaggaacattcaaaataatgtatcctgttat
ttggaagggaaacagattcatggagaacaacttgatccacatgtaactgcattcaacttg
aatagtgtgcctttcattaggaataaagggacaaatatctattgtgaggcaagtcaagga
aatgtcagtgaaggcatgaaaggcatcgttctttttgtctcaaaagtacttgaggagccc
aaggacttttcttgtgaaaccgaggacttcaagactttgcactgtacttgggatcctggg
acggacactgccttggggtggtctaaacaaccttcccaaagctacactttatttgaatca
ttttctggggaaaagaaactttgtacacacaaaaactggtgtaattggcaaataactcaa
gactcacaagaaacctataacttcacactcatagctgaaaattacttaaggaagagaagt
gtcaatatcctttttaacctgactcatcgagtttatttaatgaatccttttagtgtcaac
tttgaaaatgtaaatgccacaaatgccatcatgacctggaaggtgcactccataaggaat
aatttcacatatttgtgtcagattgaactccatggtgaaggaaaaatgatgcaatacaat
gtttccatcaaggtgaacggtgagtacttcttaagtgaactggaacctgccacagagtac
atggcgcgagtacggtgtgctgatgccagccacttctggaaatggagtgaatggagtggt
cagaacttcaccacacttgaagctgctccctcagaggcccctgatgtctggagaattgtg
agcttggagccaggaaatcatactgtgaccttattctggaagccattatcaaaactgcat
gccaatggaaagatcctgttctataatgtagttgtagaaaacctagacaaaccatccagt
tcagagctccattccattccagcaccagccaacagcacaaaactaatccttgacaggtgt
tcctaccaaatctgcgtcatagccaacaacagtgtgggtgcttctcctgcttctgtaata
gtcatctctgcagaccccgaaaacaaagaggttgaggaagaaagaattgcaggcacagag
ggtggattctctctgtcttggaaaccccaacctggagatgttataggctatgttgtggac
tggtgtgaccatacccaggatgtgctcggtgatttccagtggaagaatgtaggtcccaat
accacaagcacagtcattagcacagatgcttttaggccaggagttcgatatgacttcaga
atttatgggttatctacaaaaaggattgcttgtttattagagaaaaaaacaggatactct
caggaacttgctccttcagacaaccctcacgtgctggtggatacattgacatcccactcc
ttcactctgagttggaaagattactctactgaatctcaacctggttttatacaagggtac
catgtctatctgaaatccaaggcgaggcagtgccacccacgatttgaaaaggcagttctt
tcagatggttcagaatgttgcaaatacaaaattgacaacccggaagaaaaggcattgatt
gtggacaacctaaagccagaatccttctatgagtttttcatcactccattcactagtgct
ggtgaaggccccagtgctacgttcacgaaggtcacgactccggatgaacactcctcgatg
ctgattcatatcctactgcccatggttttctgcgtcttgctcatcatggtcatgtgctac
ttgaaaagtcagtggatcaaggagacctgttatcctgacatccctgacccttacaagagc
agcatcctgtcattaataaaattcaaggagaaccctcacctaataataatgaatgtcagt
gactgtatcccagatgctattgaagttgtaagcaagccagaagggacaaagatacagttc
ctaggcactaggaagtcactcacagaaaccgagttgactaagcctaactacctttatctc
cttccaacagaaaagaatcactctggccctggcccctgcatctgttttgagaacttgacc
tataaccaggcagcttctgactctggctcttgtggccatgttccagtatccccaaaagcc
ccaagtatgctgggactaatgacctcacctgaaaatgtactaaaggcactagaaaaaaac
tacatgaactccctgggagaaatcccagctggagaaacaagtttgaattatgtgtcccag
ttggcttcacccatgtttggagacaaggacagtctcccaacaaacccagtagaggcacca
cactgttcagagtataaaatgcaaatggcagtctccctgcgtcttgccttgcctcccccg
accgagaatagcagcctctcctcaattacccttttagatccaggtgaacactactgctaa

DBGET integrated database retrieval system