KEGG   Homo sapiens (human): 91801
Entry
91801             CDS       T01001                                 

Gene name
ALKBH8, ABH8, MRT71, TRM9, TRMT9, TRMT9A
Definition
(RefSeq) alkB homolog 8, tRNA methyltransferase
  KO
K10770  alkylated DNA repair protein alkB homolog 8 [EC:1.14.11.- 2.1.1.229]
Organism
hsa  Homo sapiens (human)
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    91801 (ALKBH8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     91801 (ALKBH8)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.229  tRNA (carboxymethyluridine34-5-O)-methyltransferase
     91801 (ALKBH8)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    91801 (ALKBH8)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2 Methyltransf_11 DUF1891 Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_12 Methyltransf_8 RRM_1 Ubie_methyltran MetW 2OG-FeII_Oxy
Other DBs
NCBI-GeneID: 91801
NCBI-ProteinID: NP_001287939
OMIM: 613306
HGNC: 25189
Ensembl: ENSG00000137760
Vega: OTTHUMG00000157008
Pharos: Q96BT7(Tbio)
UniProt: Q96BT7
Structure
PDB: 
3THT 3THP 2CQ2

Position
11q22.3
AA seq 664 aa
MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQ
LLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFV
EKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFG
YEFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHID
THSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFD
TVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSF
PESDKEASRLEQEYVHQVYEEIAGHFSSTRHTPWPHIVEFLKALPSGSIVADIGCGNGKY
LGINKELYMIGCDRSQNLVDICRERQFQAFVCDALAVPVRSGSCDACISIAVIHHFATAE
RRVAALQEIVRLLRPGGKALIYVWAMEQEYNKQKSKYLRGNRNSQGKKEEMNSDTSVQRS
LVEQMRDMGSRDSASSVPRINDSQEGGCNSRQVSNSKLPVHVNRTSFYSQDVLVPWHLKG
NPDKGKPVEPFGPIGSQDPSPVFHRYYHVFREGELEGACRTVSDVRILQSYYDQGNWCVI
LQKA
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggacagcaaccatcaaagtaattacaaactcagtaaaactgagaagaagttcttaagg
aaacagattaaagccaagcatactttgctgagacatgaaggcattgagacagtatcctat
gccactcagagcctggttgttgccaatggtggtttgggtaatggtgtgagtcggaaccag
ctgctcccggttttagagaaatgtggactggtggatgctctcttaatgccacctaacaag
ccgtactcatttgcaagatacagaactacagaagaatctaagagagcctatgttaccctc
aatggaaaagaagtagtggatgatttaggacaaaagatcactctgtatttgaattttgtg
gaaaaagtgcagtggaaggagttgaggcctcaagccttaccaccaggactcatggtagta
gaagaaataatttcttctgaggaggagaaaatgcttttggaaagtgttgattggacagaa
gatacagacaatcaaaactctcaaaaatccttaaaacacagaagagtaaagcattttggt
tatgagttccactatgagaacaacaatgtagataaagataagccattatctgggggtctt
cctgacatttgtgaaagctttttggagaaatggttgaggaaaggttacattaaacataaa
cctgatcaaatgaccataaatcagtatgaacctgggcaaggaattcccgctcatattgat
acacattccgcttttgaggatgagatcgtttctctcagtttggggtcagagattgtcatg
gattttaagcacccagatggcattgcagtgccagttatgttgcctcgtcggagtttgctg
gtgatgacaggagaatctagatacctttggacccatggaatcacgtgcagaaaatttgat
actgttcaagcatctgagagtcttaaaagtggaattatcaccagtgatgttggagactta
actttaagcaagaggggactacgaacatcatttacatttaggaaagtgaggcaaacacct
tgtaactgtagttacccgttggtctgtgatagccagaggaaagagactcccccctcattt
ccagagagtgataaagaagcctcacggctggagcaagagtacgtccatcaggtttatgaa
gagattgctgggcacttcagcagcacaagacataccccttggccgcacattgtggagttt
ttgaaggctttgccaagtggttcaatagtggctgatattggatgtggtaatggaaagtat
cttggcatcaataaggagttatatatgattggttgtgatcgtagccaaaaccttgtggac
atttgtagagagaggcaatttcaggcttttgtctgtgatgcattggcagtaccagtccgc
agtgggtcttgtgatgcctgcatctccattgctgttattcatcattttgcaacagcagag
cgtagagtggcagctctccaagaaattgttcgactcctgagaccaggtgggaaggcactc
atttatgtctgggcaatggaacaagaatataataagcagaagtccaagtatcttagagga
aacagaaatagccaaggaaagaaagaggagatgaacagtgatacctcagtgcagaggtca
cttgtggagcaaatgcgtgacatgggcagtcgagactcggcatcttctgtcccccgcatt
aatgactctcaggaaggaggatgtaattcaaggcaagtttctaattccaagctgcctgtt
catgttaacaggacttctttttattctcaagatgtactggttccctggcaccttaaggga
aatcctgataaaggcaaacctgttgagccatttggtcccataggatcccaggacccaagt
cctgtgtttcatcgttactaccatgtgttccgtgagggagaactggaaggtgcctgcagg
actgtgagtgatgtcagaattctgcaaagctactacgatcaaggaaactggtgtgtgatt
cttcaaaaggcctga

DBGET integrated database retrieval system