KEGG   Homo sapiens (human): 9181
Entry
9181              CDS       T01001                                 

Gene name
ARHGEF2, GEF, GEF-H1, GEFH1, LFP40, Lfc, NEDMHM, P40
Definition
(RefSeq) Rho/Rac guanine nucleotide exchange factor 2
  KO
K12791  Rho guanine nucleotide exchange factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9181 (ARHGEF2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    9181 (ARHGEF2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9181 (ARHGEF2)
   05131 Shigellosis
    9181 (ARHGEF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9181 (ARHGEF2)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    9181 (ARHGEF2)
SSDB
Motif
Pfam: PH_16 RhoGEF C1_1 PH C1_2 Prok-RING_1 zinc_ribbon_9 PHD
Other DBs
NCBI-GeneID: 9181
NCBI-ProteinID: NP_001155855
OMIM: 607560
HGNC: 682
Ensembl: ENSG00000116584
Vega: OTTHUMG00000017464
Pharos: Q92974(Tbio)
UniProt: Q92974
Structure
PDB: 
5EFX

Position
1q22
AA seq 986 aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERP
SSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVI
YELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLER
RRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLYKELYARDK
RFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALG
LVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLL
WKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL
ISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQK
DRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIR
EVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSD
SSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRA
NSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLR
ESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPP
QPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHS
PRDFTRMQDIPEETESRDGEAVASES
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgtctcggatcgaatccctcacgcgggcgcggatcgaccggagcagagagctggcgagc
aagacccgggaaaaggagaagatgaaggaagccaaggatgcccgctataccaatgggcac
ctcttcaccaccatttcagtttcaggcatgaccatgtgctatgcctgtaacaagagcatc
acagccaaggaagccctcatctgcccaacctgcaatgtgactatccacaaccgctgtaaa
gacaccctcgccaactgtaccaaggtcaagcagaagcaacagaaagcggccctgctgaag
aacaacaccgccttgcagtccgtttctcttcgaagtaagacaaccatccgggagcggcca
agctcggccatctacccctccgacagcttccggcagtccctcctgggctcccgccgtggc
cgctcctccttgtctttagccaagagtgtttctaccaccaacattgctggacatttcaat
gatgagtctcccctggggctgcgccggatcctctcacagtccacagactccctcaacatg
cggaaccgaaccctatccgtggaatccctcattgacgaagcagaggtaatctacagtgag
ctgatgagtgactttgagatggatgagaaggactttgcagctgactcttggagtcttgct
gtggacagcagcttcctgcagcagcataaaaaggaggtgatgaagcagcaagatgtcatc
tatgagctaatccagacagagctgcaccatgtgaggacactgaagatcatgacccgcctc
ttccgcacggggatgctggaagagctacacttggagccaggagtggtccagggcctgttc
ccctgcgtggacgagctcagtgacatccatacacgcttcctcagccagctattagaacgc
cgacgccaggccctgtgccctggcagcacccggaactttgtcatccatcgcttgggtgat
ctgctcatcagccagttctcaggtcctagtgcggagcagatgtgtaagacctactcggag
ttctgcagccgccacagcaaggccttaaagctctataaggagctgtacgcccgagacaaa
cgcttccagcaattcatccggaaagtgacccgccccgccgtgctcaagcggcacggggta
caggagtgcatcctgctggtgactcagcgcatcaccaagtacccgttactcatcagccgc
atcctgcagcattcccacgggatcgaggaggagcgccaggacctgaccacagcactgggg
ctagtgaaggagctgctgtccaatgtggacgagggtatttatcagctggagaaaggggcc
cgtctgcaggagatctacaaccgcatggaccctcgggcccaaaccccagtgcctggcaag
ggcccctttggccgagaggaacttctgaggcgcaaactcatccacgatggctgcctgctc
tggaagacagcgacggggcgcttcaaagatgtgctagtgctgctgatgacagatgtactg
gtgtttctccaggaaaaggaccagaagtacatctttcctaccctggacaagccttcagtg
gtatcgctgcagaatctaatcgtacgagacattgccaaccaggagaaagggatgtttctg
atcagcgcagccccacctgagatgtacgaggtgcacacagcatcccgggatgaccggagc
acctggatccgggtcattcagcagagcgtgcgcacatgcccatccagggaggacttcccc
ctgattgagacagaggatgaggcttacctgcggcgaattaagatggagttgcagcagaag
gaccgggcactggtggagctgctgcgagagaaggtcgggctgtttgctgagatgacccat
ttccaggccgaagaggatggtggcagtgggatggccctgcccaccctgcccaggggcctt
ttccgctctgagtcccttgagtcccctcgtggcgagcggctgctgcaggatgccatccgt
gaggtggagggtctgaaagacctgctggtggggccaggagtggaactgctcttgacaccc
cgagagccagccctgcccttggaaccagacagcggtggtaacacgagtcctggggtcact
gccaatggtgaggccagaaccttcaatggctccattgaactctgcagagctgactcagac
tctagccagagggatcgaaatggaaatcagctgagatcaccgcaagaggaggcgttacag
cgattggtcaatctctatggacttctacatggcctacaggcagctgtggcccagcaggac
actctgatggaagcccggttccctgagggccctgagcggcgggagaagctgtgccgagcc
aactctcgggatggggaggctggcagggctggggctgcccctgtggcccctgaaaagcag
gccacggaactggcattactgcagcggcaacatgcgctgctgcaggaggagctacggcgc
tgccggcggctaggtgaagaacgggcaaccgaagctggcagcctggaggcccggctccgg
gagagtgagcaggcccgggcactgctggagcgtgaggccgaagaggctcgaaggcagctg
gccgccctgggccagaccgagccactcccagctgaggccccctgggcccgcagacctgtg
gatcctcggcggcgcagcctccccgcaggcgatgccctgtacttgagtttcaacccccca
cagcccagccgaggcactgaccgcctggatctacctgtcactactcgctctgtccatcga
aactttgaggaccgagagaggcaggaactggggagccccgaagagcggctgcaagacagc
agtgaccctgacactggcagcgaggaggaaggtagcagccgtctgtctccgccccacagt
ccacgagactttaccagaatgcaggacatcccggaggagacggagagccgcgacggggag
gctgtagcctccgagagctaa

DBGET integrated database retrieval system