KEGG   Homo sapiens (human): 9182Help
Entry
9182              CDS       T01001                                 

Gene name
RASSF9, P-CIP1, PAMCI, PCIP1
Definition
(RefSeq) Ras association domain family member 9
  KO
K09856  Ras association domain-containing protein 9/10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    9182 (RASSF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA DUF3087
Motif
Other DBs
NCBI-GeneID: 9182
NCBI-ProteinID: NP_005438
OMIM: 610383
HGNC: 15739
Ensembl: ENSG00000198774
Vega: OTTHUMG00000169831
Pharos: O75901(Tdark)
UniProt: O75901
Position
12q21.31
AA seq 435 aa AA seqDB search
MAPFGRNLLKTRHKNRSPTKDMDSEEKEIVVWVCQEEKLVCGLTKRTTSADVIQALLEEH
EATFGEKRFLLGKPSDYCIIEKWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKADAF
LPVPLWRTAEAKLVQNTEKLWELSPANYMKTLPPDKQKRIVRKTFRKLAKIKQDTVSHDR
DNMETLVHLIISQDHTIHQQVKRMKELDLEIEKCEAKFHLDRVENDGENYVQDAYLMPSF
SEVEQNLDLQYEENQTLEDLSESDGIEQLEERLKYYRILIDKLSAEIEKEVKSVCIDINE
DAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQMKAKEYELL
AKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHS
QDSETTVGDVVLLST
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctccctttggaagaaacttgctaaagactcggcataaaaacagatctccaactaaa
gacatggattcagaagagaaggaaattgtggtttgggtttgccaagaagagaagcttgtc
tgtgggctgactaaacgcaccacctctgctgatgtcatccaggctttgcttgaggaacat
gaggctacgtttggagagaaacgatttcttctggggaagcccagtgattactgcatcata
gagaagtggagaggctccgaaagggttcttcctccactaactagaatcctgaagctttgg
aaagcgtggggagatgagcagcccaatatgcaatttgttttggttaaagcagatgctttt
cttccagttcctttgtggcggacagctgaagccaaattagtgcaaaacacagaaaaattg
tgggagctcagcccagcaaactacatgaagactttaccaccagataaacaaaaaagaata
gtcaggaaaactttccggaaactggctaaaattaagcaggacacagtttctcatgatcga
gataatatggagacattagttcatctgatcatttcccaggaccatactattcatcagcaa
gtcaagagaatgaaagagctggatctggaaattgaaaagtgtgaagctaagttccatctt
gatcgagtagaaaatgatggagaaaactatgttcaggatgcatatttaatgcccagtttc
agtgaagttgagcaaaatctagacttgcagtatgaggaaaaccagactctggaggacctg
agcgaaagtgatggaattgaacagctggaagaacgactgaaatattaccgaatactcatt
gataagctctctgctgaaatagaaaaagaggtaaaaagtgtttgcattgatataaatgaa
gatgcggaaggggaagctgcaagtgaactggaaagctctaatttagagagtgttaagtgt
gatttggagaaaagcatgaaagctggtttgaaaattcactctcatttgagtggcatccag
aaagagattaaatacagtgactcattgcttcagatgaaagcaaaagaatatgaactcctg
gccaaggaattcaattcacttcacattagcaacaaagatgggtgccagttaaaggaaaac
agagcgaaggaatctgaggttcccagtagcaatggggagattcctccctttactcaaaga
gtatttagcaattacacaaatgacacagactcggacactggtatcagttctaaccacagt
caggactccgaaacaacagtaggagatgtggtgctgttgtcaacatag

DBGET integrated database retrieval system