KEGG   Homo sapiens (human): 91833
Entry
91833             CDS       T01001                                 

Gene name
WDR20, Bun107, DMR
Definition
(RefSeq) WD repeat domain 20
  KO
K24741  WD repeat-containing protein 20
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    91833 (WDR20)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   91833 (WDR20)
Motif
Pfam: WD40 ANAPC4_WD40 PD40 Ge1_WD40 eIF2A
Other DBs
NCBI-GeneID: 91833
NCBI-ProteinID: NP_653175
OMIM: 617741
HGNC: 19667
Ensembl: ENSG00000140153
Vega: OTTHUMG00000171753
Pharos: Q8TBZ3(Tbio)
UniProt: Q8TBZ3
Structure
PDB: 
5K19 5K1C

Position
14q32.31
AA seq 569 aa
MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSG
NGDRLCFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLV
GFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVKWVPGSESLFLVAHSSGNMYLYNVE
HTCGTTAPHYQLLKQGESFAVHTCKSKSTRNPLLKWTVGEGALNEFAFSPDGKFLACVSQ
DGFLRVFNFDSVELHGTMKSYFGGLLCVCWSPDGKYIVTGGEDDLVTVWSFVDCRVIARG
HGHKSWVSVVAFDPYTTSVEEGDPMEFSGSDEDFQDLLHFGRDRANSTQSRLSKRNSTDS
RPVSVTYRFGSVGQDTQLCLWDLTEDILFPHQPLSRARTHTNVMNATSPPAGSNGNSVTT
PGNSVPPPLPRSNSLPHSAVSNAGSKSSVMDGAIASGVSKFATLSLHDRKERHHEKDHKR
NHSMGHISSKSSDKLNLVTKTKTDPAKTLGTPLCPRMEDVPLLEPLICKKIAHERLTVLI
FLEDCIVTACQEGFICTWGRPGKVVSFNP
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggcgacggagggaggagggaaggagatgaacgagattaagacccaattcaccacccgg
gaaggtctgtacaagctgctgccgcactcggagtacagccggcccaaccgggtgcccttc
aactcgcagggatccaaccctgtccgcgtctccttcgtaaacctcaacgaccagtctggc
aacggcgaccgcctctgcttcaatgtgggccgggagctgtacttctatatctacaagggg
gtccgcaaggctgctgacttgagtaaaccaatagataaaaggatatacaaaggaacacag
cctacttgtcatgacttcaaccacctaacagccacagcagaaagtgtctctctcctagtg
ggcttttccgcaggccaagtccagcttatagacccaatcaaaaaagaaactagcaaactt
tttaatgaggaaagactaatagacaagtcacgagttacctgtgtcaaatgggttcccggt
tcggaaagccttttcctagtagcccactcgagtgggaacatgtacttatataatgtggag
cacacttgtggcaccacagccccccactaccagcttctgaagcagggagagagctttgcc
gtgcacacttgcaagagcaaatccacgaggaaccctctccttaagtggacggtgggcgag
ggggccctcaacgagtttgctttctccccagatggcaagttcttagcgtgcgtgagccag
gacgggtttctgcgggtgttcaactttgactcagtggagctgcacggtacgatgaaaagc
tactttgggggcttgctgtgtgtgtgctggagcccggatggcaagtacatcgtgacaggt
ggggaggacgacttggtgacagtctggtcctttgtagactgccgagtaatagccagaggc
cacgggcacaagtcctgggtcagtgttgtagcgtttgacccttataccactagtgtagaa
gaaggtgaccctatggagtttagtggcagcgatgaggacttccaagaccttcttcatttt
ggcagagatcgagcaaatagtacacagtccaggctctccaaacggaactctacagacagc
cgccccgtaagtgtcacgtatcggtttggttccgtgggccaggacacacagctctgttta
tgggaccttacagaagatatccttttccctcaccaacccctctcaagagcaaggacacac
acaaatgtcatgaatgccacgagtcctcctgctggaagcaatgggaacagtgttacaaca
cccgggaactctgtgccgcctcctctgccacggtccaacagccttccacattcagcagtc
tcaaatgctggcagcaaaagcagtgtcatggacggggccattgcttctggggtcagcaaa
tttgcaacactttcactacatgaccggaaggagaggcaccacgagaaagatcacaagcga
aatcatagcatgggacacatttctagcaagagcagtgacaaactgaatctagttaccaaa
accaaaacggaccctgctaaaactctgggaacgcccctgtgtcctcgaatggaagatgtt
cccttgttagagccgctgatatgtaaaaagatagcacatgagagactgactgtactaata
tttcttgaagactgtatagtcactgcttgtcaggagggatttatttgcacatggggaagg
cctggtaaagtggtaagttttaatccttaa

DBGET integrated database retrieval system