KEGG   Homo sapiens (human): 91851
Entry
91851             CDS       T01001                                 
Symbol
CHRDL1, CHL, MGC1, MGCN, NRLN1, VOPT, dA141H5.1
Name
(RefSeq) chordin like 1
  KO
K24520  chordin-like protein 1
Organism
hsa  Homo sapiens (human)
Disease
H02104  Megalocornea
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    91851 (CHRDL1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Von Willebrand domain-containing proteins
  VWC domain-containing proteins
   91851 (CHRDL1)
SSDB
Motif
Pfam: CHRDL_1_2_C VWC Amnionless
Other DBs
NCBI-GeneID: 91851
NCBI-ProteinID: NP_660277
OMIM: 300350
HGNC: 29861
Ensembl: ENSG00000101938
Pharos: Q9BU40(Tbio)
UniProt: Q9BU40
Position
X:complement(110673856..110795817)
AA seq 456 aa
MRKKWKMGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLV
YCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPDSLPPVNNKVTSKSCEYNGT
TYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRG
DGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQQ
ASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKKI
HCPNRYPCKYPQKIDGKCCKVCPGKKAKELPGQSFDNKGYFCGEETMPVYESVFMEDGET
TRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFT
EGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgagaaaaaagtggaaaatgggaggcatgaaatacatcttttcgttgttgttctttctt
ttgctagaaggaggcaaaacagagcaagtaaaacattcagagacatattgcatgtttcaa
gacaagaagtacagagtgggtgagagatggcatccttacctggaaccttatgggttggtt
tactgcgtgaactgcatctgctcagagaatgggaatgtgctttgcagccgagtcagatgt
ccaaatgttcattgcctttctcctgtgcatattcctcatctgtgctgccctcgctgccca
gactccttacccccagtgaacaataaggtgaccagcaagtcttgcgagtacaatgggaca
acttaccaacatggagagctgttcgtagctgaagggctctttcagaatcggcaacccaat
caatgcacccagtgcagctgttcggagggaaacgtgtattgtggtctcaagacttgcccc
aaattaacctgtgccttcccagtctctgttccagattcctgctgccgggtatgcagagga
gatggagaactgtcatgggaacattctgatggtgatatcttccggcaacctgccaacaga
gaagcaagacattcttaccaccgctctcactatgatcctccaccaagccgacaggctgga
ggtctgtcccgctttcctggggccagaagtcaccggggagctcttatggattcccagcaa
gcatcaggaaccattgtgcaaattgtcatcaataacaaacacaagcatggacaagtgtgt
gtttccaatggaaagacctattctcatggcgagtcctggcacccaaacctccgggcattt
ggcattgtggagtgtgtgctatgtacttgtaatgtcaccaagcaagagtgtaagaaaatc
cactgccccaatcgatacccctgcaagtatcctcaaaaaatagacggaaaatgctgcaag
gtgtgtccaggtaaaaaagcaaaagaacttccaggccaaagctttgacaataaaggctac
ttctgcggggaagaaacgatgcctgtgtatgagtctgtattcatggaggatggggagaca
accagaaaaatagcactggagactgagagaccacctcaggtagaggtccacgtttggact
attcgaaagggcattctccagcacttccatattgagaagatctccaagaggatgtttgag
gagcttcctcacttcaagctggtgaccagaacaaccctgagccagtggaagatcttcacc
gaaggagaagctcagatcagccagatgtgttcaagtcgtgtatgcagaacagagcttgaa
gatttagtcaaggttttgtacctggagagatctgaaaagggccactgttag

DBGET integrated database retrieval system