KEGG   Homo sapiens (human): 91860Help
Entry
91860             CDS       T01001                                 

Gene name
CALML4, NY-BR-20
Definition
(RefSeq) calmodulin like 4
  KO
K02183  calmodulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04744  Phototransduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa05010  Alzheimer disease
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05133  Pertussis
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05214  Glioma
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Lubeluzole: D04789
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    91860 (CALML4)
   04015 Rap1 signaling pathway
    91860 (CALML4)
   04371 Apelin signaling pathway
    91860 (CALML4)
   04020 Calcium signaling pathway
    91860 (CALML4)
   04070 Phosphatidylinositol signaling system
    91860 (CALML4)
   04024 cAMP signaling pathway
    91860 (CALML4)
   04022 cGMP-PKG signaling pathway
    91860 (CALML4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    91860 (CALML4)
   04218 Cellular senescence
    91860 (CALML4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    91860 (CALML4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    91860 (CALML4)
   04922 Glucagon signaling pathway
    91860 (CALML4)
   04912 GnRH signaling pathway
    91860 (CALML4)
   04915 Estrogen signaling pathway
    91860 (CALML4)
   04921 Oxytocin signaling pathway
    91860 (CALML4)
   04916 Melanogenesis
    91860 (CALML4)
   04924 Renin secretion
    91860 (CALML4)
   04925 Aldosterone synthesis and secretion
    91860 (CALML4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    91860 (CALML4)
   04270 Vascular smooth muscle contraction
    91860 (CALML4)
  09154 Digestive system
   04970 Salivary secretion
    91860 (CALML4)
   04971 Gastric acid secretion
    91860 (CALML4)
  09156 Nervous system
   04728 Dopaminergic synapse
    91860 (CALML4)
   04720 Long-term potentiation
    91860 (CALML4)
   04722 Neurotrophin signaling pathway
    91860 (CALML4)
  09157 Sensory system
   04744 Phototransduction
    91860 (CALML4)
   04740 Olfactory transduction
    91860 (CALML4)
   04750 Inflammatory mediator regulation of TRP channels
    91860 (CALML4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    91860 (CALML4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    91860 (CALML4)
  09162 Cancer: specific types
   05214 Glioma
    91860 (CALML4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    91860 (CALML4)
  09165 Substance dependence
   05031 Amphetamine addiction
    91860 (CALML4)
   05034 Alcoholism
    91860 (CALML4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    91860 (CALML4)
  09171 Infectious disease: bacterial
   05133 Pertussis
    91860 (CALML4)
   05152 Tuberculosis
    91860 (CALML4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    91860 (CALML4)
   05163 Human cytomegalovirus infection
    91860 (CALML4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    91860 (CALML4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    91860 (CALML4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    91860 (CALML4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    91860 (CALML4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    91860 (CALML4)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     91860 (CALML4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    91860 (CALML4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     91860 (CALML4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   91860 (CALML4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_9 EF-hand_4 EF-hand_11 FlgD
Motif
Other DBs
NCBI-GeneID: 91860
NCBI-ProteinID: NP_219501
HGNC: 18445
Ensembl: ENSG00000129007
Vega: OTTHUMG00000133287
Pharos: Q96GE6(Tdark)
UniProt: Q96GE6
Position
15q23
AA seq 196 aa AA seqDB search
MAAEHLLPGPPPSLADFRLEAGGKGTERGSGSSKPTGSSRGPRMAKFLSQDQINEYKECF
SLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQI
KQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKV
KYDEFIHKITLPGRDY
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgagcatttattacccgggcctccacccagcttggcagactttagacttgag
gctggaggaaagggaactgaacgcggttctgggagcagcaagcccacgggtagcagccga
ggccccagaatggccaagtttctttcccaagaccaaattaatgagtacaaggaatgcttc
tccctgtatgacaagcagcagagggggaagataaaagccaccgacctcatggtggccatg
aggtgcctgggggccagcccgacgccaggggaggtgcagcggcacctgcagacccacggg
atagacggaaatggagagctggatttctccacttttctgaccattatgcacatgcaaata
aaacaagaagacccaaagaaagaaattcttctagccatgttgatggtggacaaggagaag
aaaggttacgtcatggcgtccgacctgcggtcaaaactcacgagtctgggggagaagctc
acccacaaggaagtggatgatctcttcagggaagcagatatcgaacccaatggcaaagtg
aagtatgatgaatttatccacaagatcacccttcctggacgggactattga

DBGET integrated database retrieval system