KEGG   Homo sapiens (human): 91869
Entry
91869             CDS       T01001                                 

Symbol
RFT1, CDG1N
Name
(RefSeq) RFT1 homolog
  KO
K06316  oligosaccharide translocation protein RFT1
Organism
hsa  Homo sapiens (human)
Network
nt06015  N-Glycan biosynthesis
  Element
N00830  Transport of Man5GlcNAc2-PP-dolichol
N00831  Mutation-inactivated RFT1 to transport of Man5GlcNAc2-PP-dolichol
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    91869 (RFT1)
Transporters [BR:hsa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   91869 (RFT1)
SSDB
Motif
Pfam: Rft-1
Other DBs
NCBI-GeneID: 91869
NCBI-ProteinID: NP_443091
OMIM: 611908
HGNC: 30220
Ensembl: ENSG00000163933
Vega: OTTHUMG00000074035
Pharos: Q96AA3(Tbio)
UniProt: Q96AA3
Position
3p21.1
AA seq 541 aa
MGSQEVLGHAARLASSGLLLQVLFRLITFVLNAFILRFLSKEIVGVVNVRLTLLYSTTLF
LAREAFRRACLSGGTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYA
TGVVLFGLSAVVELLGEPFWVLAQAHMFVKLKVIAESLSVILKSVLTAFLVLWLPHWGLY
IFSLAQLFYTTVLVLCYVIYFTKLLGSPESTKLQTLPVSRITDLLPNITRNGAFINWKEA
KLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPIEESF
YIFFAKVLERGKDATLQKQEDVAVAAAVLESLLKLALLAGLTITVFGFAYSQLALDIYGG
TMLSSGSGPVLLRSYCLYVLLLAINGVTECFTFAAMSKEEVDRYNFVMLALSSSFLVLSY
LLTRWCGSVGFILANCFNMGIRITQSLCFIHRYYRRSPHRPLAGLHLSPVLLGTFALSGG
VTAVSEVFLCCEQGWPARLAHIAVGAFCLGATLGTAFLTETKLIHFLRTQLGVPRRTDKM
T
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgggcagccaggaggtgctgggccacgcggcccggctggcctcctccggtctcctcctg
caggtgttgtttcggttgatcacctttgtcttgaatgcatttattcttcgcttcctgtca
aaggaaatcgttggcgtagtaaatgtaagactaacgctgctttactcaaccaccctcttc
ctggccagagaggccttccgcagagcatgtctcagtgggggcacccagcgagactggagc
cagaccctcaacctgctgtggctaacagtccccctgggtgtgttttggtccttattcctg
ggctggatctggttgcagctgcttgaagtgcctgatcctaatgttgtccctcactatgca
actggagtggtgctgtttggtctctcggcagtggtggagcttctaggagagcccttttgg
gtcttggcacaagcacatatgtttgtgaagctcaaggtgattgcagagagcctgtcggta
attcttaagagcgttctgacagcttttctcgtgctgtggttgcctcactggggattgtac
attttctctttggcccagcttttctataccacagttctggtgctctgctatgttatttat
ttcacaaagttactgggttccccagaatcaaccaagcttcaaactcttcctgtctccaga
ataacagatctgttacccaatattacaagaaatggagcgtttataaactggaaagaggct
aaactgacttggagttttttcaaacagtctttcttgaaacagattttgacagaaggcgag
cgatatgtgatgacatttttgaatgtattgaactttggtgatcagggtgtgtatgatata
gtgaataatcttggctcccttgtggccagattaattttccagccaatagaggaaagtttt
tatatattttttgctaaggtgctggagaggggaaaggatgccacacttcagaagcaggag
gacgttgctgtggctgctgcagtcttggagtccctgctcaagctggccctgctggccggc
ctgaccatcactgtttttggctttgcctattctcagctggctctggatatctacggaggg
accatgcttagctcaggatccggtcctgttttgctgcgttcctactgtctctatgttctc
ctgcttgccatcaatggagtgacagagtgtttcacatttgctgccatgagcaaagaggag
gtcgacaggtacaattttgtgatgctggccctgtcctcctcattcctggtgttatcctat
ctcttgacccgttggtgtggcagcgtgggcttcatcttggccaactgctttaacatgggc
attcggatcacgcagagcctttgcttcatccaccgctactaccgaaggagcccccacagg
cccctggctggcctgcacctatcgccagtcctgctcgggacatttgccctcagtggtggg
gttactgctgtttcggaggtattcctctgctgtgagcagggctggccagccagactggca
cacattgctgtgggggccttctgtctgggagcaactctcgggacagcattcctcacagag
accaagctgatccatttcctcaggactcagttaggtgtgcccagacgcactgacaaaatg
acatga

DBGET integrated database retrieval system