KEGG   Homo sapiens (human): 9189Help
Entry
9189              CDS       T01001                                 

Gene name
ZBED1, ALTE, DREF, TRAMP, hDREF
Definition
(RefSeq) zinc finger BED-type containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-BED Dimer_Tnp_hAT DUF4413
Motif
Other DBs
NCBI-GeneID: 9189
NCBI-ProteinID: NP_001164606
OMIM: 300178
HGNC: 447
Ensembl: ENSG00000214717
Vega: OTTHUMG00000021069
Pharos: O96006(Tbio)
UniProt: O96006 A0A024RBU4
Structure
PDB: 

Position
Xp22.33 and Yp11.2
AA seq 694 aa AA seqDB search
MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNT
SNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDS
KKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAV
REVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSMGSRCLKTFEVPE
ENTAETITRVLYEVFIEWGISAKVFGATTNYGKDIVKACSLLDVAVHMPCLGHTFNAGIQ
QAFQLPKLGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAM
LQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTIS
MVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYK
RLPFLSAFERQQVENRVVEEAKGLLDKVKDGGYRPAEDKIFPVPEEPPVKKLMRTSTPPP
ASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPL
LPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRLAPAHVDEQVFLYENARSGAEAEPE
DQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggagaataaaagcctggagagctcccagacagacctgaagctggtggcccacccccgc
gccaagagcaaggtgtggaagtatttcggcttcgacaccaacgccgagggatgcatcctg
cagtggaagaaaatctactgccgcatctgcatggcccagatcgcctactccggaaacacc
tccaacctgtcctaccacctggagaagaaccaccccgaggaattctgcgagttcgtcaag
agcaacacggagcagatgcgtgaagccttcgccaccgccttctccaagctgaagcccgag
tcgtcccagcagcccgggcaggacgcgctggccgtcaaggccggccacggctacgacagc
aagaagcagcaggagctgacggccgccgtgctgggcctcatctgcgaggggctgtaccca
gcctccatcgtggacgagcccaccttcaaggtgctgctgaagacggccgacccccggtat
gagctgcccagccggaagtacatctctaccaaggccatccctgagaagtacggggccgtc
cgggaggtgatcctgaaggagctggccgaggccacctggtgtggcatctccaccgacatg
tggaggagtgagaatcagaaccgcgcctacgtcacgctggccgcccacttcctgggcctg
ggcgcccccaactgcctgtccatgggctcccgctgcctgaagaccttcgaggtgcccgaa
gagaacacggcggagaccatcacgcgagtgctctatgaggtcttcatcgagtggggcatc
agcgccaaggtcttcggggccaccaccaactatggcaaggacatcgtgaaggcgtgctcc
ctgctggacgtcgcagtgcacatgccctgcctgggccacaccttcaatgccggcatccag
caggccttccagctcccgaagctgggggcgctgctgtcgcgctgccgcaaactggtggag
tacttccagcagtctgccgtggccatgtacatgctctatgagaagcagaagcagcagaac
gtggcccactgcatgctggtgagcaaccgcgtctcctggtgggggagcacgctggccatg
ctgcagcgcctcaaggagcagcagttcgtcatcgccggggtcttggtggaggacagcaac
aaccaccacctcatgctggaggccagcgagtgggccaccatcgaggggctggtggagctc
ctgcagcccttcaagcaggtggccgagatgctgtcggcctccaggtaccccaccatcagc
atggtgaagccgctgctgcacatgctcctgaacaccacgctcaacatcaaggagaccgac
tccaaggagctcagcatggccaaggaggtcatcgccaaggagctttccaagacctaccag
gagacgcccgagatcgacatgtttctcaacgtggccaccttcctggacccccgctacaag
aggctgcccttcctctccgccttcgagcggcagcaggtggagaatcgcgtggtggaagag
gccaagggcctgctggacaaggtcaaagacggcggctaccggccggctgaggacaagatc
ttcccggtgcccgaggagcctcccgtcaagaagctcatgcggacatccacgccgccgccc
gccagcgtcatcaacaacatgctggccgagatcttctgccagacaggcggcgtggaggac
caggaagagtggcatgcccaggtggtggaggagctgagcaacttcaagtcccagaaggtg
cttggcctcaacgaagaccccctcaagtggtggtcagaccgcctggccctcttccccctg
ctgcccaaggtgctgcagaagtactggtgcgtgacggccacgcgcgtcgcccctgagcgt
ctcttcggatccgccgccaacgtggtcagcgccaagaggaaccggctggctcccgcgcac
gtggacgagcaggtgtttctgtatgagaacgcccggagtggggcagaggcggaacccgag
gaccaggacgagggggagtggggcctggaccaggagcaggtgttctccttgggggatggc
gtcagcggcggtttctttggcattagggacagcagcttcctgtag

DBGET integrated database retrieval system