KEGG   Homo sapiens (human): 9191Help
Entry
9191              CDS       T01001                                 

Gene name
DEDD, CASP8IP1, DEDD1, DEFT, FLDED1, KE05
Definition
(RefSeq) death effector domain containing
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DED
Motif
Other DBs
NCBI-GeneID: 9191
NCBI-ProteinID: NP_001034800
OMIM: 606841
HGNC: 2755
Ensembl: ENSG00000158796
Vega: OTTHUMG00000033104
Pharos: O75618(Tbio)
UniProt: O75618
Position
1q23.3
AA seq 318 aa AA seqDB search
MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEE
TSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRR
KSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRD
LGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEED
YELGRQKLLRNLMLQALP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcctaaagcggcgggcaagccaggtgtggccagaagagcatggtgagcaggaa
catgggctgtacagcctgcaccgcatgtttgacatcgtgggcactcatctgacacacaga
gatgtgcgcgtgctttctttcctctttgttgatgtcattgatgaccacgagcgtggactc
atccgaaatggacgtgacttcttattggcactggagcgccagggccgctgtgatgaaagt
aactttcgccaggtgctgcagctgctgcgcatcatcactcgccacgacctgctgccctac
gtcaccctcaagaggagacgggctgtgtgccctgatcttgtagacaagtatctggaggag
acatcaattcgctatgtgacccccagagccctcagtgatccagaaccaaggcctccccag
ccctctaaaacagtgcctccccactatcctgtggtgtgttgccccacttcgggtcctcag
atgtgtagcaagcggccagcccgagggagagccacacttgggagccagcgaaaacgccgg
aagtcagtgacaccagatcccaaggagaagcagacatgtgacatcagactgcgggttcgg
gctgaatactgccagcatgagactgctctgcagggcaatgtcttctctaacaagcaggac
ccacttgagcgccagtttgagcgctttaaccaggccaacaccatcctcaagtcccgggac
ctgggctccatcatctgtgacatcaagttctctgagctcacctacctcgatgcattctgg
cgtgactacatcaatggctctttattagaggcacttaaaggtgtcttcatcacagactcc
ctcaagcaagctgtgggccatgaagccatcaagctgctggtaaatgtagacgaggaggac
tatgagctgggccgacagaaactcctgaggaacttgatgctgcaagcattgccctga

DBGET integrated database retrieval system