KEGG   Homo sapiens (human): 91947Help
Entry
91947             CDS       T01001                                 

Gene name
ARRDC4
Definition
(RefSeq) arrestin domain containing 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C Vps26 Rgp1
Motif
Other DBs
NCBI-GeneID: 91947
NCBI-ProteinID: NP_899232
HGNC: 28087
Ensembl: ENSG00000140450
Vega: OTTHUMG00000149849
Pharos: Q8NCT1(Tdark)
UniProt: Q8NCT1 A0A024RC80 A8K2F6
Position
15q26.2
AA seq 418 aa AA seqDB search
MGGEAGCAAAVGAEGRVKSLGLVFEDERKGCYSSGETVAGHVLLEASEPVALRALRLEAQ
GRATAAWGPSTCPRASASTAALAVFSEVEYLNVRLSLREPPAGEGIILLQPGKHEFPFRF
QLPSEPLVTSFTGKYGSIQYCVRAVLERPKVPDQSVKRELQVVSHVDVNTPALLTPVLKT
QEKMVGCWFFTSGPVSLSAKIERKGYCNGEAIPIYAEIENCSSRLIVPKAAIFQTQTYLA
SGKTKTIRHMVANVRGNHIASGSTDTWNGKTLKIPPVTPSILDCCIIRVDYSLAVYIHIP
GAKKLMLELPLVIGTIPYNGFGSRNSSIASQFSMDMSWLTLTLPEQPEAPPNYADVVSEE
EFSRHIPPYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEESQPVSFIL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggaggctgggtgcgcggcggccgtgggtgccgagggccgcgtgaagagcctg
ggtctggtgttcgaggacgagcgcaagggctgctattccagcggcgagacagtggccggg
cacgtgctgctggaggcgtccgagccggtggccctgcgcgcgctgcgcctggaggcccag
gggcgcgccaccgccgcctggggcccgagcacctgcccccgcgcctcggccagcaccgcg
gccctggctgtcttctcggaggtggagtacctgaacgtgcgcctcagcctgcgggagccc
ccggccggtgaaggcatcattttattacagcctggaaaacatgaatttccatttcgcttt
caacttccatctgaacctttggtcacctcgtttactgggaaatatggaagcattcagtac
tgtgtgcgggcagtgttggaacgacccaaggtacctgatcagagtgtaaagcgggaactc
caggttgttagtcatgtcgatgtcaacacaccagcattattaacccctgtattgaaaact
caagagaaaatggttggctgttggtttttcacttctggtccagtctcgctgagtgccaaa
attgaaagaaagggatactgtaatggagaagctattccaatctatgcagaaatagaaaat
tgttcctctcgtctgattgttccaaaggctgctattttccaaacgcagacatatttggct
agtggaaaaacaaagaccattcgacacatggtcgccaatgtgcgaggaaaccacatcgct
tctgggagcacagacacatggaatgggaaaacgctaaaaatcccacctgttactccatcc
atcctggattgctgcattatcagagtggactattccttagctgtatacattcacattcct
ggtgctaaaaaattgatgctcgaactgccattagtgatcggtacaattccatataatggt
tttggcagcagaaactccagcattgccagccagttcagtatggatatgagctggttgaca
ctgaccctgccagagcagcctgaagcaccaccaaattatgcagatgtggtatcagaggaa
gaattctctagacacattcctccttaccctcaaccccctaactgtgagggagaagtgtgc
tgtcctgtgtttgcctgtatacaagaattccggtttcaacccccacctctttattcagag
gttgacccacatcctagcgacgtagaagagagccagcctgtttccttcattctctga

DBGET integrated database retrieval system