KEGG   Homo sapiens (human): 9197Help
Entry
9197              CDS       T01001                                 

Gene name
SLC33A1, ACATN, AT-1, AT1, CCHLND, SPG42
Definition
(RefSeq) solute carrier family 33 member 1
  KO
K03372  MFS transporter, PAT family, solute carrier family 33 (acetyl-CoA transportor), member 1 [EC:2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00604  Glycosphingolipid biosynthesis - ganglio series
hsa01100  Metabolic pathways
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    9197 (SLC33A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9197 (SLC33A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     9197 (SLC33A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC33: Acetyl-CoA transporter
   9197 (SLC33A1)
 Major Facilitator Superfamily (MFS)
  Protein transporters
   Peptide-acetyl-CoA transporter (PAT) [TC:2.A.1.25]
    9197 (SLC33A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acatn
Motif
Other DBs
NCBI-GeneID: 9197
NCBI-ProteinID: NP_001177921
OMIM: 603690
HGNC: 95
Ensembl: ENSG00000169359
Vega: OTTHUMG00000158481
Pharos: O00400(Tbio)
UniProt: O00400
Position
3q25.31
AA seq 549 aa AA seqDB search
MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGD
FLKAPQSFRAELSSILLLLFLYVLQGIPLGLAGSIPLILQSKNVSYTDQAFFSFVFWPFS
LKLLWAPLVDAVYVKNFGRRKSWLVPTQYILGLFMIYLSTQVDRLLGNTDDRTPDVIALT
VAFFLFEFLAATQDIAVDGWALTMLSRENVGYASTCNSVGQTAGYFLGNVLFLALESADF
CNKYLRFQPQPRGIVTLSDFLFFWGTVFLITTTLVALLKKENEVSVVKEETQGITDTYKL
LFAIIKMPAVLTFCLLILTAKIGFSAADAVTGLKLVEEGVPKEHLALLAVPMVPLQIILP
LIISKYTAGPQPLNTFYKAMPYRLLLGLEYALLVWWTPKVEHQGGFPIYYYIVVLLSYAL
HQVTVYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECV
GASNQNCRTPDAVELCKKLGGSCVTALDGYYVESIICVFIGFGWWFFLGPKFKKLQDEGS
SSWKCKRNN
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccaccatctcccacaaggacagcagccggcaacggcggccagggaatttcagt
cactctctggatatgaagagcggtcccctgccgccaggcggttgggatgacagtcatttg
gactcagcgggccgggaaggggacagagaagctcttctgggggataccggcactggcgac
ttcttaaaagccccacagagcttccgggccgaactaagcagcattttgctactactcttt
ctttacgtgcttcagggtattcccctgggcttggcgggaagcatcccactcattttgcaa
agcaaaaatgttagctatacagaccaagctttcttcagttttgtcttttggcccttcagt
ctcaaattactctgggccccgttggttgatgcggtctacgttaagaacttcggtcgtcgc
aaatcttggcttgtcccgacacagtatatactaggactcttcatgatctatttatccact
caggtggaccgtttgcttgggaataccgatgacagaacacccgacgtgattgctctcact
gtggcgttctttttgtttgaattcttggccgccactcaggacattgccgtcgatggttgg
gcgttaactatgttatccagggaaaatgtgggttatgcttctacttgcaattcggtgggc
caaacagcgggttactttttgggcaatgttttgtttttggcccttgaatctgccgacttt
tgtaacaaatatttgcggtttcagcctcaacccagaggaatcgttactctttcagatttc
ctttttttctggggaactgtatttttaataacaacaacattggttgcccttctgaaaaaa
gaaaacgaagtatcagtagtaaaagaagaaacacaagggatcacagatacttacaagctg
ctttttgcaattataaaaatgccagcagttctgacattttgccttctgattctaactgca
aagattggtttttcagcagcagatgctgtaacaggactgaaattggtagaagagggagta
cccaaagaacatttagccttattggcagttccaatggttcctttgcagataatactgcct
ctgattatcagcaaatacactgcaggtccccagccattaaacacattttacaaagccatg
ccctacagattattgcttgggttagaatatgccctactggtttggtggactcctaaagta
gaacatcaagggggattccctatatattactatatcgtagtcctgctgagttatgcttta
catcaggttacagtgtacagcatgtatgtttctataatggctttcaatgcaaaggttagt
gatccacttattggaggaacatacatgacccttttaaataccgtgtccaatctgggagga
aactggccttctacagtagctctttggcttgtagatcccctcacagtaaaagagtgtgta
ggagcatcaaaccagaattgtcgaacacctgatgctgttgagctttgcaaaaaactgggt
ggctcatgtgttacagccctggatggttattatgtggagtccattatttgtgttttcatt
ggatttggttggtggttctttcttggtccaaaatttaaaaagttacaggatgaaggatca
tcttcgtggaaatgcaaaaggaacaattaa

DBGET integrated database retrieval system