KEGG   Homo sapiens (human): 91975Help
Entry
91975             CDS       T01001                                 

Gene name
ZNF300
Definition
(RefSeq) zinc finger protein 300
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    91975 (ZNF300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    91975 (ZNF300)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    91975 (ZNF300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 C1_4 zf-C2H2_jaz DUF3268 ADK_lid
Motif
Other DBs
NCBI-GeneID: 91975
NCBI-ProteinID: NP_443092
OMIM: 612429
HGNC: 13091
Ensembl: ENSG00000145908
Vega: OTTHUMG00000130076
Pharos: Q96RE9(Tbio)
UniProt: Q96RE9
Position
5q33.1
AA seq 604 aa AA seqDB search
MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKL
EQGEEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGS
LCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETDIS
IQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQSEPNSNLEKIHNGVIP
FDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCG
ACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGEKPYECSECGK
AFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCE
KSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQL
IIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQ
RIHTGEKPYICAECGKAFSQKSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHT
VVKS
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtcccaggggttagtatcattcaaggatgtggctgtggatttcacccaggag
gagtggcagcaacttgacccttctcagaggaccctgtacagggatgtgatgctggagaac
tacagccacctggtctcaatggggtatccagtttccaaaccagatgtcatctccaagttg
gaacaaggagaagagccatggatcataaagggagacatatcaaattggatctatccagat
gaatatcaggcagatgggagacaagacaggaagagtaaccttcacaactcccagtcatgt
attttggggacagtttccttccatcataagatactgaaaggagtcacaagggatggttca
ttgtgctccattttaaaagtctgtcaaggtgatggtcagctgcagagatttctagagaat
caagacaaactcttcaggcaggtcacatttgttaacagcaaaacagtgactgaggcatca
gggcataaatataatccactggggaaaatatttcaagagtgcatagaaacagatatatca
atacagagattccataaatatgatgcttttaaaaagaacttaaaaccaaatattgaccta
ccgagttgttataagagcaattcaagaaaaaaacctgatcagagttttggaggtggaaaa
tcatctagccagagtgagcccaattctaatcttgagaagattcacaatggagtaatacct
tttgatgataatcagtgtggaaacgtttttagaaatacacaatcccttattcaatatcag
aatgtggaaactaaagagaaaagctgtgtatgtgttacatgtggaaaagcctttgctaag
aagtcacaactcattgtacatcaaagaattcatactggaaagaaaccatatgattgtggt
gcatgcggaaaagccttcagtgagaagtttcatcttgttgtacatcagagaactcatact
ggggagaaaccttatgattgttctgaatgtggaaaagccttctctcagaaatcgtccctt
attatacatcagagagttcacactggggaaaaaccctatgaatgtagtgaatgcgggaaa
gccttctcccagaaatcacccctcattatacatcagagaatacatactggggaaaaaccc
tatgaatgtagagagtgtgggaaggccttttcccagaagtcacagctgattatacaccac
agagctcatactggagagaagccgtatgagtgtaccgaatgtgggaaagccttctgtgag
aagtcccacctcattatacataaaagaattcacactggtgagaaaccctacaaatgtgct
caatgtgaggaagccttcagcaggaagacagaactcattacacatcagttagttcatact
ggggaaaaaccttatgaatgtactgaatgtggaaagacattctcccgcaagtcacagctc
atcatacatcagagaacacatactggagaaaaaccctataaatgtagtgaatgtggcaaa
gccttctgccagaagtcacatctcattggacatcagagaattcacacaggagaaaaacct
tatatatgtactgaatgtgggaaagccttctctcagaagtcccaccttccgggacaccag
cgaattcatacaggagagaaaccttacatatgtgctgaatgtggaaaggccttttctcag
aagtcagaccttgttttacatcagaggattcatactggggaaagaccctatcaatgtgct
atatgtgggaaggccttcatccagaagtcacaactaactgtacaccagagaattcacaca
gtggtaaaatcataa

DBGET integrated database retrieval system