KEGG   Homo sapiens (human): 920Help
Entry
920               CDS       T01001                                 

Gene name
CD4, CD4mut
Definition
(RefSeq) CD4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05340  Primary immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Cedelizumab: D03420
Ibalizumab: D09575
Priliximab: D05610
Zanolimumab: D06356
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    920 (CD4)
   04514 Cell adhesion molecules (CAMs)
    920 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    920 (CD4)
   04612 Antigen processing and presentation
    920 (CD4)
   04660 T cell receptor signaling pathway
    920 (CD4)
   04658 Th1 and Th2 cell differentiation
    920 (CD4)
   04659 Th17 cell differentiation
    920 (CD4)
 09160 Human Diseases
  09162 Immune diseases
   05340 Primary immunodeficiency
    920 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    920 (CD4)
CD molecules [BR:hsa04090]
 Proteins
  920 (CD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD4-extracel C2-set ig Tcell_CD4_C V-set I-set Ig_3 Ig_2 Receptor_2B4 Ig_5 Herpes_gE P_proprotein
Motif
Other DBs
NCBI-GeneID: 920
NCBI-ProteinID: NP_000607
OMIM: 186940
HGNC: 1678
Ensembl: ENSG00000010610
Vega: OTTHUMG00000168514
Pharos: P01730(Tchem)
UniProt: P01730 B4DT49
Structure
PDB: 

Position
12p13.31
AA seq 458 aa AA seqDB search
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggggagtcccttttaggcacttgcttctggtgctgcaactggcgctcctccca
gcagccactcagggaaagaaagtggtgctgggcaaaaaaggggatacagtggaactgacc
tgtacagcttcccagaagaagagcatacaattccactggaaaaactccaaccagataaag
attctgggaaatcagggctccttcttaactaaaggtccatccaagctgaatgatcgcgct
gactcaagaagaagcctttgggaccaaggaaactttcccctgatcatcaagaatcttaag
atagaagactcagatacttacatctgtgaagtggaggaccagaaggaggaggtgcaattg
ctagtgttcggattgactgccaactctgacacccacctgcttcaggggcagagcctgacc
ctgaccttggagagcccccctggtagtagcccctcagtgcaatgtaggagtccaaggggt
aaaaacatacagggggggaagaccctctccgtgtctcagctggagctccaggatagtggc
acctggacatgcactgtcttgcagaaccagaagaaggtggagttcaaaatagacatcgtg
gtgctagctttccagaaggcctccagcatagtctataagaaagagggggaacaggtggag
ttctccttcccactcgcctttacagttgaaaagctgacgggcagtggcgagctgtggtgg
caggcggagagggcttcctcctccaagtcttggatcacctttgacctgaagaacaaggaa
gtgtctgtaaaacgggttacccaggaccctaagctccagatgggcaagaagctcccgctc
cacctcaccctgccccaggccttgcctcagtatgctggctctggaaacctcaccctggcc
cttgaagcgaaaacaggaaagttgcatcaggaagtgaacctggtggtgatgagagccact
cagctccagaaaaatttgacctgtgaggtgtggggacccacctcccctaagctgatgctg
agtttgaaactggagaacaaggaggcaaaggtctcgaagcgggagaaggcggtgtgggtg
ctgaaccctgaggcggggatgtggcagtgtctgctgagtgactcgggacaggtcctgctg
gaatccaacatcaaggttctgcccacatggtccaccccggtgcagccaatggccctgatt
gtgctggggggcgtcgccggcctcctgcttttcattgggctaggcatcttcttctgtgtc
aggtgccggcaccgaaggcgccaagcagagcggatgtctcagatcaagagactcctcagt
gagaagaagacctgccagtgtcctcaccggtttcagaagacatgtagccccatttga

DBGET integrated database retrieval system