KEGG   Homo sapiens (human): 9200Help
Entry
9200              CDS       T01001                                 

Gene name
HACD1, CAP, PTPLA
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydratase 1
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00415  Fatty acid biosynthesis, elongation, endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    9200 (HACD1)
   01040 Biosynthesis of unsaturated fatty acids
    9200 (HACD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    9200 (HACD1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     9200 (HACD1)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   9200 (HACD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTPLA
Motif
Other DBs
NCBI-GeneID: 9200
NCBI-ProteinID: NP_055056
OMIM: 610467
HGNC: 9639
Ensembl: ENSG00000165996
Vega: OTTHUMG00000017750
Pharos: B0YJ81(Tbio)
UniProt: B0YJ81
Position
10p12.33
AA seq 288 aa AA seqDB search
MGRLTEAAAAGSGSRAAGWAGSPPTLLPLSPTSPRCAATMASSDEDGTNGGASEAGEDRE
APGERRRLGVLATAWLTFYDIAMTAGWLVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQT
FALLEIVHCLIGIVPTSVIVTGVQVSSRIFMVWLITHSIKPIQNEESVVLFLVAWTVTEI
TRYSFYTFSLLDHLPYFIKWARYNFFIILYPVGVAGELLTIYAALPHVKKTGMFSIRLPN
KYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIVEKDD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcctgacggaagcggcggcagcgggcagcggctctcgggctgcaggctgggca
gggtcccctcccacgctcctgccgctgtctcccacgtcccccaggtgcgcggccaccatg
gcgtccagcgacgaggacggcaccaacggcggcgcctcggaggccggcgaggaccgggag
gctcccggcgagcggaggcgcctgggggtcttggccaccgcctggctcaccttctacgac
atcgccatgaccgcggggtggttggttctagctattgccatggtacgtttttatatggaa
aaaggaacacacagaggtttatataaaagtattcagaagacacttaaatttttccagaca
tttgccttgcttgagatagttcactgtttaattggaattgtacctacttctgtgattgtg
actggggtccaagtgagttcaagaatctttatggtgtggctcattactcacagtataaaa
ccaatccagaatgaagagagtgtggtgctttttctggtcgcgtggactgtgacagagatc
actcgctattccttctacacattcagccttcttgaccacttgccatacttcattaaatgg
gccagatataatttttttatcatcttatatcctgttggagttgctggtgaacttcttaca
atatacgctgccttgccgcatgtgaagaaaacaggaatgttttcaataagacttcctaac
aaatacaatgtctcttttgactactattattttcttcttataaccatggcatcatatata
cctttgtttccacaactctattttcatatgttacgtcaaagaagaaaggtgcttcatgga
gaggtgattgtagaaaaggatgattaa

DBGET integrated database retrieval system