KEGG   Homo sapiens (human): 92014
Entry
92014             CDS       T01001                                 

Gene name
SLC25A51, CG7943, MCART1
Definition
(RefSeq) solute carrier family 25 member 51
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Mito_carr Bac_export_1
Other DBs
NCBI-GeneID: 92014
NCBI-ProteinID: NP_219480
OMIM: 619153
HGNC: 23323
Ensembl: ENSG00000122696
Vega: OTTHUMG00000019935
Pharos: Q9H1U9(Tdark)
UniProt: Q9H1U9
Position
9p13.2-p13.1
AA seq 297 aa
MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQL
YGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFAT
SGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPIL
FRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQ
SQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI
NT seq 894 nt   +upstreamnt  +downstreamnt
atgatggattcagaagctcatgaaaagaggccaccaatactaacatcttcaaaacaagat
atatcacctcatattacaaatgttggtgagatgaagcattacttgtgtggctgctgtgca
gccttcaacaatgtcgcaatcacatttcccattcagaaggtcctctttcgacaacagctg
tatggcatcaaaacccgggatgcaatacttcagttgagaagggatggatttcgaaatttg
tatcgtggaatccttcccccattgatgcagaagacaactacgcttgcacttatgtttggt
ctgtatgaggatttatcctgccttctccacaagcatgtcagtgctccagagtttgcaacc
agtggcgtggcggcagtgcttgcagggacaacagaagcaattttcactccactggaaaga
gttcagacattgcttcaagaccacaagcatcatgacaaatttaccaacacttaccaggct
ttcaaggcactgaaatgtcatggaattggagagtattatcgaggcttggtgcccattctt
ttccggaatggactcagcaatgtcttgtttttcggccttcgaggtcccattaaggagcat
ctgcctaccgcaacgactcacagtgctcatctggtcaatgattttatctgtggaggtcta
ttgggtgccatgttgggattcttgttttttccaattaatgttgtaaaaactcgcatacag
tctcagattggtggggaatttcagtctttccccaaggttttccaaaaaatctggctggaa
cgggacagaaaactgataaatcttttcagaggtgcccatctgaattaccatcggtccctc
atctcttggggcataatcaatgcaacttatgagttcttgttaaaggttatatga

DBGET integrated database retrieval system