KEGG   Homo sapiens (human): 9212
Entry
9212              CDS       T01001                                 

Gene name
AURKB, AIK2, AIM-1, AIM1, ARK-2, ARK2, AurB, IPL1, PPP1R48, STK-1, STK12, STK5, aurkb-sv1, aurkb-sv2
Definition
(RefSeq) aurora kinase B
  KO
K11479  aurora kinase B [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Drug target
Ilorasertib: D10423
Tozasertib (DG01365): D08279 D08344
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9212 (AURKB)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9212 (AURKB)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9212 (AURKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9212 (AURKB)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   9212 (AURKB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9212 (AURKB)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     9212 (AURKB)
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     9212 (AURKB)
  Sister chromatid separation proteins
   Aurora kinases
    9212 (AURKB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 9212
NCBI-ProteinID: NP_001300879
OMIM: 604970
HGNC: 11390
Ensembl: ENSG00000178999
Vega: OTTHUMG00000108189
Pharos: Q96GD4(Tchem)
UniProt: Q96GD4
Structure
PDB: 
4AF3

Position
17p13.1
AA seq 344 aa
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggcccagaaggagaactcctacccctggccctacggccgacagacggctccatctggc
ctgagcaccctgccccagcgagtcctccggaaagagcctgtcaccccatctgcacttgtc
ctcatgagccgctccaatgtccagcccacagctgcccctggccagaaggtgatggagaat
agcagtgggacacccgacatcttaacgcggcacttcacaattgatgactttgagattggg
cgtcctctgggcaaaggcaagtttggaaacgtgtacttggctcgggagaagaaaagccat
ttcatcgtggcgctcaaggtcctcttcaagtcccagatagagaaggagggcgtggagcat
cagctgcgcagagagatcgaaatccaggcccacctgcaccatcccaacatcctgcgtctc
tacaactatttttatgaccggaggaggatctacttgattctagagtatgccccccgcggg
gagctctacaaggagctgcagaagagctgcacatttgacgagcagcgaacagccacgatc
atggaggagttggcagatgctctaatgtactgccatgggaagaaggtgattcacagagac
ataaagccagaaaatctgctcttagggctcaagggagagctgaagattgctgacttcggc
tggtctgtgcatgcgccctccctgaggaggaagacaatgtgtggcaccctggactacctg
cccccagagatgattgaggggcgcatgcacaatgagaaggtggatctgtggtgcattgga
gtgctttgctatgagctgctggtggggaacccaccctttgagagtgcatcacacaacgag
acctatcgccgcatcgtcaaggtggacctaaagttccccgcttccgtgcccatgggagcc
caggacctcatctccaaactgctcaggcataacccctcggaacggctgcccctggcccag
gtctcagcccacccttgggtccgggccaactctcggagggtgctgcctccctctgccctt
caatctgtcgcctga

DBGET integrated database retrieval system