KEGG   Homo sapiens (human): 9217Help
Entry
9217              CDS       T01001                                 

Gene name
VAPB, ALS8, VAMP-B, VAP-B
Definition
(RefSeq) VAMP associated protein B and C
  KO
K10707  vesicle-associated membrane protein-associated protein B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00455  Spinal muscular atrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    9217 (VAPB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9217 (VAPB)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   9217 (VAPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Motile_Sperm ZapB bZIP_1 GIT_CC LcrG ATP-synt_G
Motif
Other DBs
NCBI-GeneID: 9217
NCBI-ProteinID: NP_004729
OMIM: 605704
HGNC: 12649
Ensembl: ENSG00000124164
Vega: OTTHUMG00000032840
Pharos: O95292(Tbio)
UniProt: O95292 Q53XM7
Structure
PDB: 

Position
20q13.32
AA seq 243 aa AA seqDB search
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI
IDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLR
CVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV
QRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGK
IAL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggtggagcaggtcctgagcctcgagccgcagcacgagctcaaattccgaggt
cccttcaccgatgttgtcaccaccaacctaaagcttggcaacccgacagaccgaaatgtg
tgttttaaggtgaagactacagcaccacgtaggtactgtgtgaggcccaacagcggaatc
atcgatgcaggggcctcaattaatgtatctgtgatgttacagcctttcgattatgatccc
aatgagaaaagtaaacacaagtttatggttcagtctatgtttgctccaactgacacttca
gatatggaagcagtatggaaggaggcaaaaccggaagaccttatggattcaaaacttaga
tgtgtgtttgaattgccagcagagaatgataaaccacatgatgtagaaataaataaaatt
atatccacaactgcatcaaagacagaaacaccaatagtgtctaagtctctgagttcttct
ttggatgacaccgaagttaagaaggttatggaagaatgtaagaggctgcaaggtgaagtt
cagaggctacgggaggagaacaagcagttcaaggaagaagatggactgcggatgaggaag
acagtgcagagcaacagccccatttcagcattagccccaactgggaaggaagaaggcctt
agcacccggctcttggctctggtggttttgttctttatcgttggtgtaattattgggaag
attgccttgtag

DBGET integrated database retrieval system