KEGG   Homo sapiens (human): 9218Help
Entry
9218              CDS       T01001                                 

Gene name
VAPA, VAP-33, VAP-A, VAP33, hVAP-33
Definition
(RefSeq) VAMP associated protein A
  KO
K06096  vesicle-associated membrane protein-associated protein A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    9218 (VAPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9218 (VAPA)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    9218 (VAPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Motile_Sperm ASH YabB bZIP_1 UL45 GIT_CC
Motif
Other DBs
NCBI-GeneID: 9218
NCBI-ProteinID: NP_919415
OMIM: 605703
HGNC: 12648
Ensembl: ENSG00000101558
Vega: OTTHUMG00000131603
Pharos: Q9P0L0(Tbio)
UniProt: Q9P0L0
Structure
PDB: 

Position
18p11.22
AA seq 249 aa AA seqDB search
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYC
VRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDE
LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECK
RLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFI
GFFLGKFIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcctcaggggccatggcgaagcacgagcagatcctggtcctcgatccgccc
acagacctcaaattcaaaggccccttcacagatgtagtcactacaaatcttaaattgcga
aatccatcggatagaaaagtgtgtttcaaagtgaagactacagcacctcgccggtactgt
gtgaggcccaacagtggaattattgacccagggtcaactgtgactgtttcagtaatgcta
cagccctttgactatgatccgaatgaaaagagtaaacacaagtttatggtacagacaatt
tttgctccaccaaacacttcagatatggaagctgtgtggaaagaggcaaaacctgatgaa
ttaatggattccaaattgagatgcgtatttgaaatgcccaatgaaaatgataaattgaat
gatatggaacctagcaaagctgttccactgaatgcatctaagcaagatggacctatgcca
aaaccacacagtgtttcacttaatgataccgaaacaaggaaactaatggaagagtgtaaa
agacttcagggagaaatgatgaagctatcagaagaaaatcggcacctgagagatgaaggt
ttaaggctcagaaaggtagcacattcggataaacctggatcaacctcaactgcatccttc
agagataatgtcaccagtcctcttccttcacttcttgttgtaattgcagccattttcatt
ggattctttctagggaaattcatcttgtag

DBGET integrated database retrieval system