KEGG   Homo sapiens (human): 922
Entry
922               CDS       T01001                                 

Gene name
CD5L, AIM, API6, CT-2, PRO229, SP-ALPHA, Spalpha, hAIM
Definition
(RefSeq) CD5 molecule like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SRCR SRCR_2 Hepsin-SRCR
Other DBs
NCBI-GeneID: 922
NCBI-ProteinID: NP_001334627
OMIM: 602592
HGNC: 1690
Ensembl: ENSG00000073754
Vega: OTTHUMG00000022440
Pharos: O43866(Tbio)
UniProt: O43866
Position
1q23.1
AA seq 347 aa
MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAV
LCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDA
GASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLG
CGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED
PFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLGCGKSLSPSFRDRKC
YGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSV
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggctctgctattctccttgatccttgccatttgcaccagacctggattcctagcgtct
ccatctggagtgcggctggtggggggcctccaccgctgtgaagggcgggtggaggtggaa
cagaaaggccagtggggcaccgtgtgtgatgacggctgggacattaaggacgtggctgtg
ttgtgccgggagctgggctgtggagctgccagcggaacccctagtggtattttgtatgag
ccaccagcagaaaaagagcaaaaggtcctcatccaatcagtcagttgcacaggaacagaa
gatacattggctcagtgtgagcaagaagaagtttatgattgttcacatgatgaagatgct
ggggcatcgtgtgagaacccagagagctctttctccccagtcccagagggtgtcaggctg
gctgacggccctgggcattgcaagggacgcgtggaagtgaagcaccagaaccagtggtat
accgtgtgccagacaggctggagcctccgggccgcaaaggtggtgtgccggcagctggga
tgtgggagggctgtactgactcaaaaacgctgcaacaagcatgcctatggccgaaaaccc
atctggctgagccagatgtcatgctcaggacgagaagcaacccttcaggattgcccttct
gggccttgggggaagaacacctgcaaccatgatgaagacacgtgggtcgaatgtgaagat
ccctttgacttgagactagtaggaggagacaacctctgctctgggcgactggaggtgctg
cacaagggcgtatggggctctgtctgtgatgacaactggggagaaaaggaggaccaggtg
gtatgcaagcaactgggctgtgggaagtccctctctccctccttcagagaccggaaatgc
tatggccctggggttggccgcatctggctggataatgttcgttgctcaggggaggagcag
tccctggagcagtgccagcacagattttgggggtttcacgactgcacccaccaggaagat
gtggctgtcatctgctcagtgtag

DBGET integrated database retrieval system