KEGG   Homo sapiens (human): 9221
Entry
9221              CDS       T01001                                 
Symbol
NOLC1, NOPP130, NOPP140, NS5ATP13, P130, Srp40
Name
(RefSeq) nucleolar and coiled-body phosphoprotein 1
  KO
K25818  nucleolar and coiled-body phosphoprotein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9221 (NOLC1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    Others
     9221 (NOLC1)
SSDB
Motif
Pfam: SRP40_C
Other DBs
NCBI-GeneID: 9221
NCBI-ProteinID: NP_004732
OMIM: 602394
HGNC: 15608
Ensembl: ENSG00000166197
Position
10:102152389..102163870
AA seq 699 aa
MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKS
AKVPERKLQANGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAA
AKASESSSSEESSDDDDEEDQKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPP
KNQKPKITPVTVKAQTKAPPKPARAAPKIANGKAASSSSSSSSSSSSDDSEEEKAAATPK
KTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKKPMKNKPGPYSSVPPPSAPPP
KKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATTKPPPAKKAAE
SSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRK
ADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEE
EEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPR
PQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQA
KKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQ
VLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcggacgccggcattcgccgcgtggttcccagcgacctgtatcccctcgtgctcggc
ttcctgcgcgataaccaactctcagaggtggccaataagttcgccaaagcgacaggagct
acacagcaggatgccaatgcctcttccctcttagacatctatagcttctggctcaagtct
gccaaggtcccagagcgaaagttacaggcaaatggaccagtggctaagaaagctaagaag
aaggcctcatccagtgacagtgaggacagcagcgaggaggaggaggaagttcaagggcct
ccagcaaagaaggctgctgtacctgccaagcgagtcggtctgcctcctgggaaggctgca
gccaaagcatcagagagtagcagcagtgaagagtccagtgatgatgatgatgaggaggac
caaaagaaacagcctgtccagaagggagttaagccccaagccaaggcagccaaagctcct
cctaagaaggccaagagctctgattctgattctgactcaagctccgaggatgagccacca
aagaaccagaagccaaagataacacctgtgacagttaaagctcagactaaagcccctccc
aaaccagctcgagcagcacctaaaatagccaatggtaaagcagccagtagcagcagtagc
agcagcagcagcagtagcagtgatgactcagaggaggagaaggcagcagccacccccaag
aagactgtacctaaaaagcaagttgtggccaaggccccagtgaaagcagctaccacccct
acccggaagagttctagcagtgaggattcctccagtgacgaggaagaggagcaaaaaaaa
cccatgaaaaataaaccaggtccctacagttcagtccccccgccttctgctcccccacca
aagaagtctctgggaacccagcctcccaagaaggctgtggagaagcagcagcctgtggaa
agcagtgaagacagcagtgatgagtctgattcaagttctgaagaagagaagaaaccccca
actaaggcagtagtctctaaagcaaccactaaaccacctccagcaaagaaagcagcagag
agctcttcagacagctcagactctgacagctctgaggatgatgaagctccttctaagcca
gctggtaccaccaagaattcttcaaataagccagctgtcaccaccaagtcacctgcagtg
aagccagctgcagcccccaagcaacctgtgggcggtggccagaagcttctgacgagaaag
gctgacagcagctccagtgaggaagagagcagctccagtgaggaggagaagacaaagaag
atggtggccaccactaagcccaaggcgactgccaaagcagctctatctctgcctgccaag
caggctcctcagggtagtagggacagcagctctgattcagacagctccagcagtgaggag
gaggaagagaagacatctaagtctgcagttaagaagaagccacagaaggtagcaggaggt
gcagccccttccaagccagcctctgcaaagaaaggaaaggctgagagcagcaacagttct
tcttctgatgactccagtgaggaagaggaagagaagctcaagggcaagggctctccaaga
ccacaagcccccaaggccaatggcacctctgcactgactgcccagaatggaaaagcagct
aagaacagtgaggaggaggaagaagaaaagaaaaaggcggcagtggtagtttccaaatca
ggttcattaaagaagcggaagcagaatgaggctgccaaggaggcagagactcctcaggcc
aagaagataaagcttcagacccctaacacatttccaaaaaggaagaaaggagaaaaaagg
gcatcatccccattccgaagggtcagggaggaggaaattgaggtggattcacgagttgcg
gacaactcctttgatgccaagcgaggtgcagccggagactggggagagcgagccaatcag
gttttgaagttcaccaaaggcaagtcctttcggcatgagaaaaccaagaagaagcggggc
agctaccggggaggctcaatctctgtccaggtcaattctattaagtttgacagcgagtga

DBGET integrated database retrieval system