KEGG   Homo sapiens (human): 923Help
Entry
923               CDS       T01001                                 

Gene name
CD6, TP120
Definition
(RefSeq) CD6 molecule
  KO
K06456  T-cell surface glycoprotein CD6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    923 (CD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    923 (CD6)
CD molecules [BR:hsa04090]
 Proteins
  923 (CD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRCR SRCR_2 TMEM154
Motif
Other DBs
NCBI-GeneID: 923
NCBI-ProteinID: NP_006716
OMIM: 186720
HGNC: 1691
Ensembl: ENSG00000013725
Vega: OTTHUMG00000167823
Pharos: P30203(Tbio)
UniProt: P30203 Q6AZ88 Q8N4Q7
Structure
PDB: 

Position
11q12.2
AA seq 668 aa AA seqDB search
MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEV
RLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANAT
LAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHG
EWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK
VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLC
SASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDS
GSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTA
NPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP
NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDND
DYDDISAA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttcttcgggatcactggattgctgacggcagccctctcaggtcatccatct
ccagccccacctgaccagctcaacaccagcagtgcagagagtgagctctgggagccaggg
gagcggcttccggtccgtctgacaaacgggagcagcagctgcagcgggacggtggaggtg
cggctcgaggcgtcctgggagcccgcgtgcggggcgctctgggacagccgcgccgccgag
gccgtgtgccgagcactgggctgcggcggggcggaggccgcctctcagctcgccccgccg
acccctgagctgccgcccccgcctgcagccgggaacaccagcgtagcagctaatgccact
ctggccggggcgcccgccctcctgtgcagcggcgccgagtggcggctctgcgaggtggtg
gagcacgcgtgccgcagcgacgggaggcgggcccgtgtcacctgtgcagagaaccgcgcg
ctgcgcctggtggacggtggcggcgcctgcgccggccgcgtggagatgctggagcatggc
gagtggggatcagtgtgcgatgacacttgggacctggaggacgcccacgtggtgtgcagg
caactgggctgcggctgggcagtccaggccctgcccggcttgcacttcacgcccggccgc
gggcctatccaccgggaccaggtgaactgctcgggggccgaagcttacctgtgggactgc
ccggggctgccaggacagcactactgcggccacaaagaggacgcgggcgcggtgtgctca
gagcaccagtcctggcgcctgacagggggcgctgaccgctgcgaggggcaggtggaggta
cacttccgaggggtctggaacacagtgtgtgacagtgagtggtacccatcggaggccaag
gtgctctgccagtccttgggctgtggaactgcggttgagaggcccaaggggctgccccac
tccttgtccggcaggatgtactactcatgcaatggggaggagctcaccctctccaactgc
tcctggcggttcaacaactccaacctctgcagccagtcgctggcagccagggtcctctgc
tcagcttcccggagtttgcacaatctgtccactcccgaagtccctgcaagtgttcagaca
gtcactatagaatcttctgtgacagtgaaaatagagaacaaggaatctcgggagctaatg
ctcctcatcccctccatcgttctgggaattctcctccttggctccctcatcttcatagcc
ttcatcctcttgagaattaaaggaaaatatgccctccccgtaatggtgaaccaccagcac
ctacccaccaccatcccggcagggagcaatagctatcaaccggtccccatcaccatcccc
aaagaagttttcatgctgcccatccaggtccaggccccgccccctgaggactcagactct
ggctcggactcagactatgagcactatgacttcagcgcccagcctcctgtggccctgacc
accttctacaattcccagcggcatcgggtcacagatgaggaggtccagcaaagcaggttc
cagatgccacccttggaggaaggacttgaagagttgcatgcctcccacatcccaactgcc
aaccctggacactgcattacagacccgccatccctgggccctcagtatcacccgaggagc
aacagtgagtcgagcacctcttcaggggaggattactgcaatagtcccaaaagcaagctg
cctccatggaacccccaggtgttttcttcagagaggagttccttcctggagcagccccca
aacttggagctggccggcacccagccagccttttcagcagggcccccggctgatgacagc
tccagcacctcatccggggagtggtaccagaacttccagccaccaccccagcccccttcg
gaggagcagtttggctgtccagggtcccccagccctcagcctgactccaccgacaacgat
gactacgatgacatcagcgcagcctag

DBGET integrated database retrieval system