KEGG   Homo sapiens (human): 9230Help
Entry
9230              CDS       T01001                                 

Gene name
RAB11B, H-YPT3, NDAGSCW
Definition
(RefSeq) RAB11B, member RAS oncogene family
  KO
K07905  Ras-related protein Rab-11B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
hsa04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    9230 (RAB11B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9230 (RAB11B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    9230 (RAB11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9230 (RAB11B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9230 (RAB11B)
   04031 GTP-binding proteins [BR:hsa04031]
    9230 (RAB11B)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    9230 (RAB11B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9230 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   9230 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   9230 (RAB11B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    9230 (RAB11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 AAA_22 RsgA_GTPase GTP_EFTU Gtr1_RagA AAA_16 FeoB_N ABC_tran PduV-EutP SRPRB AAA_14 TniB AAA_24 FAD-SLDH AAA_21 AAA_5 AAA_7
Motif
Other DBs
NCBI-GeneID: 9230
NCBI-ProteinID: NP_004209
OMIM: 604198
HGNC: 9761
Ensembl: ENSG00000185236
Vega: OTTHUMG00000182278
Pharos: Q15907(Tbio)
UniProt: Q15907
Structure
PDB: 

Position
19p13.2
AA seq 218 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca
ggcgtgggcaagagcaacctgctgtcgcgcttcacccgcaacgagttcaacctggagagc
aagagcaccatcggcgtggagttcgccacccgcagcatccaggtggacggcaagaccatc
aaggcgcagatctgggacaccgctggccaggagcgctaccgcgccatcacctccgcgtac
taccgtggtgcagtgggcgccctgctggtgtacgacatcgccaagcacctgacctatgag
aacgtggagcgctggctgaaggagctgcgggaccacgcagacagcaacatcgtcatcatg
ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggcccgc
gccttcgcagaaaagaacaacttgtccttcatcgagacctcagccttggattccactaac
gtagaggaagcattcaagaacatcctcacagagatctaccgcatcgtgtcacagaaacag
atcgcagaccgcgctgcccacgacgagtccccggggaacaacgtggtggacatcagcgtg
ccgcccaccacggacggacagaagcccaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system