KEGG   Homo sapiens (human): 9231Help
Entry
9231              CDS       T01001                                 

Gene name
DLG5, LP-DLG, P-DLG5, PDLG
Definition
(RefSeq) discs large MAGUK scaffold protein 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 Takusan dbPDZ_assoc PDZ_2 Guanylate_kin SH3_2 SH3_1
Motif
Other DBs
NCBI-GeneID: 9231
NCBI-ProteinID: NP_004738
OMIM: 604090
HGNC: 2904
Ensembl: ENSG00000151208
Vega: OTTHUMG00000018548
Pharos: Q8TDM6(Tbio)
UniProt: Q8TDM6
Structure
PDB: 

Position
10q22.3
AA seq 1919 aa AA seqDB search
MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLL
LAKERDHFQDLRAALEKTQPHLLPILYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSS
LSSVGTTGKAPSPPPLLTDQQVNEKVENLSIQLRLMTRERNELRKRLAFATHGTAFDKRP
YHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTRL
KDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIGDLRAQQQQVLKHNGSSEILN
KLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNADLSRLEQLGEENQRLLKQTEMLTQQRD
TAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEK
YREERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQI
KDTVTMDAGRANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSI
RTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLM
AHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAEGVNEPCFPGDCGIFVTKVD
KGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNGEGAINMVVRRRKSLGGKVVTPL
HINLSGQKDSGISLENGVYAAAVLPGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESL
LRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSFRAHGPEVQAHNKRNLIQHNN
STQTDIFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDAS
GDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEK
LSVYKKPKQRKSIFDPNTFKRPQTPPKIDYLLPGPGPAHSPQPSKRAGPLTPPKPPRRSD
SIKFQHRLETSSESEATLVGSSPSTSPPSALPPDVDPGEPMHASPPRKARVRIASSYYPE
GDGDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFRPKLAPVVIPAQFLEEQKCVP
ASGELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSSILRNPIYTVR
SHRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSAR
LGSSSNLQFKAERIKIPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNIDTLSSCSQSQT
SASTLPRIAVNPASLGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVG
SIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSRS
SSHLDPAGTHSTLQGSGTTTPEHPSVIDPLMEQDEGPSTPPAKQSSSRIAGDANKKTLEP
RVVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDVRNKTV
EEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQELSFKKDDIL
YVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTL
SAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVSLAYQRVQKVDCTALR
PVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDV
TTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDK
VTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL
NT seq 5760 nt NT seq  +upstreamnt  +downstreamnt
atggagccccagcgccgggagctgctcgcccagtgtcagcagagcctggcccaggccatg
acggaggtggaagccgtgctcgggctgctcgaggccgcgggagcgctcagtcccggcgag
cggcggcagctggacgaggaggcgggaggcgccaaggcggagctgctgctcaagctgctc
ttggccaaggagcgggaccacttccaggacctgcgggcggcgctggagaagacgcagcct
cacctgctgcccattctctacctgaacggcgtcgtcgggccgccgcagcccgccgaaggc
gcgggttctacctacagcgtcctgtccaccatgccctcagactcagaaagcagcagctcc
ctcagcagtgtgggcactaccgggaaggcgccgtccccaccacccctcctcactgaccag
caagtgaatgagaaggtggagaacctctccattcagctgcggctgatgacccgggagaga
aacgagctccgcaagcgcctggcctttgctacgcatggcacggcctttgacaagaggccc
taccacaggctgaatcctgactatgagaggctgaagatccagtgcgtgcgagccatgtcg
gacctgcagagcctgcagaaccagcacaccaacgccttgaagaggtgtgaggaggtggcc
aaggagactgacttctaccacacactccacagccggctcctgagtgaccagactcggctg
aaggatgacgtggacatgctgaggcgggagaatgggcagctgctgcgggagcgaaacctg
ctgcagcagtcatgggaggacatgaagcggctccacgaggaggaccagaaggagatcggt
gacctccgtgcccagcagcagcaggtgttgaagcacaacgggtcatccgagattctcaac
aaactgtatgacacggccatggacaagttggaggtggtcaagaaggactatgacgccctt
cggaagaggtacagtgagaaagtcgccatccacaatgcagacctgagccgcctggagcag
ctgggggaggagaaccagcggttgctgaagcagacagagatgctgacccagcagagggac
acggccatccagctgcagcaccagtgcgccctctccctgaggaggtttgaggcgatccac
catgagctgaacaaggccacggcgcagaacaaggacctgcagtgggagatggagctgctg
cagtcagagctgaccgagctgagaaccacgcaggtgaagacagcaaaggagtcggagaaa
tacagggaggagcgggacgctgtgtacagcgagtacaagctcatcatgagtgagcgtgac
caggtcatctctgagctggacaagctgcagaccgaagtggagctggccgagtccaagctc
aagagcagcacatctgagaagaaggcggccaatgaggagatggaggcgctgcggcagatc
aaagacacggtgacaatggatgctgggagagccaacaaggaggttgaaatccttcgaaag
cagtgcaaggctctgtgccaggagctgaaggaagccctccaggaggcggatgtggccaag
tgccggcgggactgggccttccaggagcgagacaagattgtagcagagcgtgacagcatc
cggacactgtgtgacaacctgaggcgggagcgggaccgtgcggtgagcgagctggctgag
gccctgcgcagcctggatgacacccgcaagcagaagaatgatgtcagccgcgagctgaag
gagctcaaggaacagatggaatcccagttggaaaaggaggcccggttccgacagctgatg
gcccacagctcccacgactcggccattgacacggattccatggagtgggaaacggaagtt
gtagagttcgagagggagacggaggatattgacttgaaggcactggggtttgatatggca
gaaggtgtgaatgagccttgtttcccgggggactgtggcatatttgtcactaaagtggac
aaaggaagcattgctgatggccgcttaagggtcaatgactggctgctgagaatcaacgat
gtggacctcatcaacaaggacaagaagcaggccatcaaggcgctcctcaatggggagggg
gccatcaacatggtcgtgcggcggaggaagtccctgggtgggaaggtggtcacgccgctg
cacatcaacctcagtggacagaaagacagtggcatcagtctggagaatggagtgtatgct
gccgctgtgctgcctggaagccctgccgctaaagaagggtcccttgctgtgggagacagg
atcgttgcgatcaatggcattgcactggacaacaagtctctgaatgaatgtgaatctctg
ctgcgcagctgccaggactccctgaccctgtccctcctgaaggtattccctcagagctcc
tcgtggagtggccagaacatttttgaaaatatcaaagactctgataagatgctgagtttt
cgagcccatggcccggaggtccaggctcataacaaacggaacttgatacagcacaataac
tccacgcagacagacatcttctacacggacaggctggaagacaggaaggagccaggcccc
ccaggaggcagcagctcctttctgcataagccattccctgggggacccttgcaggtctgc
ccccaggcctgtcccagtgcctctgagcgtagcctgagctccttccgctcagatgcctct
ggggaccgtggctttgggctggtggacgtgcgtggccggcggccactgctgccctttgag
accgaggtgggcccctgtggggttggggaggcctccctggacaaggcagactctgaaggc
tccaacagcggcgggacctggcccaaggccatgctcagctccacggcagtgcctgagaag
ctctctgtttataaaaagccaaagcaaagaaagtccatctttgaccctaacactttcaaa
cgcccccagacaccccccaaaatagactacctgcttccaggtcctgggcctgctcactct
ccccagccctccaagagggcggggcctctgacacccccaaaacctcccagaaggagcgac
tccattaagttccagcacaggctggagactagctccgagtcagaagccactctggtgggc
agctccccatccactagtcccccgagcgccctgccccctgacgtggaccccggggagccc
atgcacgcatcaccccctcgcaaggccagggtccgcattgcttccagctactaccctgaa
ggagatggggactcctcccacctgccggccaagaaatcctgtgatgaggacctcacctcc
cagaaggtggatgagctggggcagaagcgtcgccggccaaaatctgctcccagttttcgg
ccgaagcttgctccagtagtgattcctgctcagttcctggaggaacagaagtgtgtcccg
gccagtggagaactctccccggagctccaggagtgggcaccttactcgcctgggcattcc
agccggcacagcaaccccccgctataccctagcaggccgtctgtgggcactgttccccgg
agtttgacccccagcaccactgtgagctccatcctgcggaaccccatctacactgtgcgc
agtcacagggtcggcccctgcagctctccacctgcggcccgagatgctggcccccagggt
ttgcatcccagtgtccagcaccagggacgcctgagcctggacctgagccacaggacctgc
agcgactactccgagatgagagccacccatgggtccaactcactgccctccagcgcccgc
ctgggttcttcgagtaacttgcagttcaaggcggaacgcattaaaatcccatcaacacca
agatatccgcggagtgtcgtgggctccgagagaggttcagtgtcacattctgaatgcagc
actcctccacagtcacccctgaacatcgacaccctgtcctcttgtagccagtcccagacc
tcagcctccacattgcccagaatcgctgtcaaccccgcgtccctcggggagcggagaaag
gacaggccttatgtggaggagccacgccacgtgaaggtgcagaagggctcagagccgctg
ggcatctccatcgtgagtggagagaagggcggcatctacgtctccaaggtgaccgtgggg
agcatcgctcaccaggctggcctcgagtatggggatcagttactggagttcaacggcata
aacctgcggagcgccacggagcagcaggcgcggctcatcatcgggcagcagtgtgatacc
atcaccatcctggcccagtacaacccccacgtgcaccagctcagcagccactcccggtcc
agctcacacctggaccctgccggtacccactccactctccagggcagtggcaccaccacc
ccggagcatccatctgtcatcgacccactgatggagcaggacgaggggcctagcaccccc
ccagccaagcagagcagctccaggattgcgggagatgccaacaagaagaccctggagcca
cgcgttgtcttcatcaaaaagtcccagctggagcttggggtgcacttgtgtggtgggaac
ctgcatggggtgtttgtggccgaggtggaggatgacagtcctgccaagggtcctgacggc
ctcgtgccaggggacctcatcctggagtatggcagcctggacgtgcggaacaagacagtg
gaggaagtctatgtggagatgctgaagcccagggatggcgtccgcctgaaggtgcagtac
cgccctgaggagttcacgaaggccaagggcctgcctggtgacagcttctacatcagggcc
ctgtacgaccggctggcagatgtggagcaagagttgagctttaagaaggacgacatcctc
tacgtggatgacaccttaccccagggcacgttcgggtcctggatggcttggcagctggac
gagaatgcccagaagatccagcgcgggcagattcccagcaaatatgtgatggaccaagaa
ttctccaggaggctcagcatgtctgaagtcaaagatgacaatagcgccacaaagacgctg
tcagcggctgcacgccggtccttttttcggaggaaacacaagcacaaacgcagcgggtcc
aaggacgggaaagacctgctcgccttggatgccttttccagtgactccattccactcttt
gaagattcggtgagcctggcctatcagcgggtccagaaggtggactgcaccgctctgagg
cctgtcctgattctggggcctttgctggacgtggtgaaggagatgctggtgaatgaggct
cctggcaagttctgcagatgtccccttgaggtgatgaaggcctcccagcaggccattgag
cggggtgtcaaagattgcctgtttgtcgactataagcggagaagcggccatttcgatgtg
accactgtggcgtcaataaaggagatcacagaaaagaaccgacactgcctcctggacatt
gctccgcacgctattgagcggctccaccacatgcacatctaccccattgtcatcttcatc
cactacaagagcgccaagcacatcaaggagcagagagaccccatctacctgagggacaag
gtgactcagaggcattccaaagagcagtttgaggcggcgcagaagcttgagcaggagtac
agcaggtacttcacaggggtcatccagggaggagccctgtcaagcatttgcactcagatc
ttggcaatggtcaatcaagaacaaaataaagtcctgtggattccagcctgcccgctctag

DBGET integrated database retrieval system