KEGG   Homo sapiens (human): 9232
Entry
9232              CDS       T01001                                 

Gene name
PTTG1, EAP1, HPTTG, PTTG, TUTR1
Definition
(RefSeq) PTTG1 regulator of sister chromatid separation, securin
  KO
K06635  securin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9232 (PTTG1)
   04114 Oocyte meiosis
    9232 (PTTG1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    9232 (PTTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9232 (PTTG1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    9232 (PTTG1)
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 9232
NCBI-ProteinID: NP_001269311
OMIM: 604147
HGNC: 9690
Ensembl: ENSG00000164611
Vega: OTTHUMG00000130328
Pharos: O95997(Tbio)
UniProt: O95997 Q6IAL9
Position
5q33.3
AA seq 202 aa
MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKAT
RKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPF
NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQ
SPSSILSTLDVELPPVCCDIDI
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctactctgatctatgttgataaggaaaatggagaaccaggcacccgtgtggttgct
aaggatgggctgaagctggggtctggaccttcaatcaaagccttagatgggagatctcaa
gtttcaacaccacgttttggcaaaacgttcgatgccccaccagccttacctaaagctact
agaaaggctttgggaactgtcaacagagctacagaaaagtctgtaaagaccaagggaccc
ctcaaacaaaaacagccaagcttttctgccaaaaagatgactgagaagactgttaaagca
aaaagctctgttcctgcctcagatgatgcctatccagaaatagaaaaattctttcccttc
aatcctctagactttgagagttttgacctgcctgaagagcaccagattgcgcacctcccc
ttgagtggagtgcctctcatgatccttgacgaggagagagagcttgaaaagctgtttcag
ctgggccccccttcacctgtgaagatgccctctccaccatgggaatccaatctgttgcag
tctccttcaagcattctgtcgaccctggatgttgaattgccacctgtttgctgtgacata
gatatttaa

DBGET integrated database retrieval system