KEGG   Homo sapiens (human): 9235Help
Entry
9235              CDS       T01001                                 

Gene name
IL32, IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd
Definition
(RefSeq) interleukin 32
  KO
K22632  interleukin 32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9235 (IL32)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9235 (IL32)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   9235 (IL32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL32
Motif
Other DBs
NCBI-GeneID: 9235
NCBI-ProteinID: NP_001295007
OMIM: 606001
HGNC: 16830
Ensembl: ENSG00000008517
Vega: OTTHUMG00000167498
Pharos: P24001(Tbio)
UniProt: P24001
Position
16p13.3
AA seq 234 aa AA seqDB search
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC
LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE
KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV
VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcccgaaggtcctctctgatgacatgaagaagctgaaggcccgaatggtaatg
ctcctccctacttctgctcaggggttgggggcctgggtctcagcgtgtgacactgaggac
actgtgggacacctgggaccctggagggacaaggatccggccctttggtgccaactctgc
ctctcttcacagcaccaggccatagaaagattttatgataaaatgcaaaatgcagaatca
ggacgtggacaggtgatgtcgagcctggcagagctggaggacgacttcaaagagggctac
ctggagacagtggcggcttattatgaggagcagcacccagagctcactcctctacttgaa
aaagaaagagatggattacggtgccgaggcaacagatcccctgtcccggatgttgaggat
cccgcaaccgaggagcctggggagagcttttgtgacaaggtcatgagatggttccaggcc
atgctgcagcggctgcagacctggtggcacggggttctggcctgggtgaaggagaaggtg
gtggccctggtccatgcagtgcaggccctctggaaacagttccagagtttctgctgctct
ctgtcagagctcttcatgtcctctttccagtcctacggagccccacggggggacaaggag
gagctgacaccccagaagtgctctgaaccccaatcctcaaaatga

DBGET integrated database retrieval system