KEGG   Homo sapiens (human): 9238Help
Entry
9238              CDS       T01001                                 

Gene name
TBRG4, CPR2, FASTKD4
Definition
(RefSeq) transforming growth factor beta regulator 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FAST_2 FAST_1 RAP FATC
Motif
Other DBs
NCBI-GeneID: 9238
NCBI-ProteinID: NP_004740
OMIM: 611325
HGNC: 17443
Ensembl: ENSG00000136270
Vega: OTTHUMG00000129247
Pharos: Q969Z0(Tbio)
UniProt: Q969Z0
Position
7p13
AA seq 631 aa AA seqDB search
MAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEK
ERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKPEDKGL
LIQDAHFHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLK
YKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVGHLSEPLMN
RLEDKCLELVEHFGPNELRKVLVMLAAQSRRSVPLLRAISYHLVQKPFSLTKDVLLDVAY
AYGKLSFHQTQVSQRLATDLLSLMPSLTSGEVAHCAKSFALLKWLSLPLFEAFAQHVLNR
AQDITLPHLCSVLLAFARLNFHPDQEDQFFSLVHEKLGSELPGLEPALQVDLVWALCVLQ
QAREAELQAVLHPEFHIQFLGGKSQKDQNTFQKLLHINATALLEYPEYSGPLLPASAVAP
GPSALDRKVTPLQKELQETLKGLLGSADKGSLEVATQYGWVLDAEVLLDSDGEFLPVRDF
VAPHLAQPTGSQSPPPGSKRLAFLRWEFPNFNSRSKDLLGRFVLARRHIVAAGFLIVDVP
FYEWLELKSEWQKGAYLKDKMRKAVAEELAK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcacctggtaaagcgatgcacgtgcctcctgagagaagctgctcgtcaggcc
cctgccatggctccagttggccgactgagacttgcctgggtagcccataagactctgact
tcctcagccacctcacccatttcccacctcccaggttccttgatggagccggtggagaag
gaacgagcatctactccctacatagagaagcaggtggaccacctcatcaagaaggccaca
aggccagaggagctcctggagctacttggtggcagtcacgacttggacagcaatcaagca
gcaatggtacttatccggctctctcacttgctgtctgagaagccagaagataaaggcttg
ctcatacaggatgcccactttcatcaacttctctgtctgctcaacagtcagattgcctcg
gtctggcatggtaccctctcgaagctgctgggaagcctgtatgctctgggcatccccaag
gcctccaaggagctgcagtcggtggagcaggaggtccgctggcgcatgcggaagctcaag
tacaagcacctggccttcctggcagagtcctgtgccaccctctcacaggagcagcactcg
caggagctgctggctgagctgctcacacacctggaaaggcgttggacagaaattgaagat
tcccacacattagtgaccgtcatgatgaaggtgggacacctctcggagccactaatgaac
cgcctggaagacaagtgcctggagttggtggagcactttggccccaatgagctgcggaag
gtgctggtgatgctggcagctcagagccggcggtccgtgcccttgctgcgggccatctcc
taccacctggtgcagaagcccttctctctgacgaaagatgtgctcttggacgtggcctat
gcctatggcaaactcagctttcaccagacccaggtgtcccagcgcctggccaccgacctg
ctatccctcatgcccagcctgacttctggtgaggtggcccactgtgccaagtccttcgcc
ttactcaagtggctcagcctgcccctgtttgaggcctttgcccagcacgtcctgaacaga
gcgcaggacatcaccctgccccacctgtgcagcgtacttctggcttttgcgcgtctgaac
ttccatccagaccaagaggatcagttcttcagcctggtacatgagaagctggggtcagag
ctgccaggcctggagccagccctgcaggtggacctggtgtgggccctgtgtgtgctgcag
caggcacgggaagcagagctgcaagccgtcctccaccctgaatttcacatccaatttcta
gggggcaagtctcagaaggatcagaacaccttccagaagctgctccacatcaacgccact
gccctgctggagtaccccgagtactcgggtccccttctgcctgcctcggctgtggcccct
gggccctcagcccttgacaggaaggtgacccccctgcaaaaggagctgcaggagacgctg
aaggggctgctggggagcgccgacaagggcagcctcgaggtggccacgcagtatggctgg
gtgctggatgctgaggtgctgctggacagtgacggcgagtttctgcccgtaagggacttt
gtggcacctcaccttgcccagccaactgggagccagtcaccacctccagggtctaagagg
ctagcgttcttgcggtgggagttccccaacttcaacagccgaagcaaggacttgctgggt
cgctttgttctggcccggcgacacatagtggctgcaggcttcctgatagtggacgtccca
ttctatgagtggctggaactcaagtctgaatggcagaaaggcgcctacctcaaggacaag
atgcgcaaagcggtggctgaggagctggccaagtga

DBGET integrated database retrieval system