KEGG   Homo sapiens (human): 9241
Entry
9241              CDS       T01001                                 

Gene name
NOG, SYM1, SYNS1, SYNS1A
Definition
(RefSeq) noggin
  KO
K04658  noggin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Disease
H00482  Brachydactyly
H00484  Multiple synostosis syndrome
H00778  Tarsal-carpal coalition syndrome
H00851  Proximal symphalangism
H00868  Stapes ankylosis with broad thumb and toes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    9241 (NOG)
SSDB
Motif
Pfam: Noggin
Other DBs
NCBI-GeneID: 9241
NCBI-ProteinID: NP_005441
OMIM: 602991
HGNC: 7866
Ensembl: ENSG00000183691
Vega: OTTHUMG00000151770
Pharos: Q13253(Tbio)
UniProt: Q13253
Structure
PDB: 
1M4U

Position
17q22
AA seq 232 aa
MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKD
LNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI
KGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFS
KRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
NT seq 699 nt   +upstreamnt  +downstreamnt
atggagcgctgccccagcctaggggtcaccctctacgccctggtggtggtcctggggctg
cgggcgacaccggccggcggccagcactatctccacatccgcccggcacccagcgacaac
ctgcccctggtggacctcatcgaacacccagaccctatctttgaccccaaggaaaaggat
ctgaacgagacgctgctgcgctcgctgctcgggggccactacgacccaggcttcatggcc
acctcgccccccgaggaccggcccggcgggggcgggggtgcagctgggggcgcggaggac
ctggcggagctggaccagctgctgcggcagcggccgtcgggggccatgccgagcgagatc
aaagggctagagttctccgagggcttggcccagggcaagaagcagcgcctaagcaagaag
ctgcggaggaagttacagatgtggctgtggtcgcagacattctgccccgtgctgtacgcg
tggaacgacctgggcagccgcttttggccgcgctacgtgaaggtgggcagctgcttcagt
aagcgctcgtgctccgtgcccgagggcatggtgtgcaagccgtccaagtccgtgcacctc
acggtgctgcggtggcgctgtcagcggcgcgggggccagcgctgcggctggattcccatc
cagtaccccatcatttccgagtgcaagtgctcgtgctag

DBGET integrated database retrieval system