KEGG   Homo sapiens (human): 92421Help
Entry
92421             CDS       T01001                                 

Gene name
CHMP4C, SNF7-3, Shax3, VPS32C
Definition
(RefSeq) charged multivesicular body protein 4C
  KO
K12194  charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    92421 (CHMP4C)
  09143 Cell growth and death
   04217 Necroptosis
    92421 (CHMP4C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    92421 (CHMP4C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92421 (CHMP4C)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    92421 (CHMP4C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   92421 (CHMP4C)
  Exosomal proteins of other body fluids (saliva and urine)
   92421 (CHMP4C)
  Exosomal proteins of colorectal cancer cells
   92421 (CHMP4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 DUF155 SYF2
Motif
Other DBs
NCBI-GeneID: 92421
NCBI-ProteinID: NP_689497
OMIM: 610899
HGNC: 30599
Ensembl: ENSG00000164695
Vega: OTTHUMG00000164726
Pharos: Q96CF2(Tbio)
UniProt: Q96CF2
Position
8q21.13
AA seq 233 aa AA seqDB search
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVH
ENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttgggcaagttctttaaagggggcggctcttctaagagccgagccgctccc
agtccccaggaggccctggtccgacttcgggagactgaggagatgctgggcaagaaacaa
gagtacctggaaaatcgaatccagagagaaatcgccctggccaagaagcacggcacgcag
aataagcgagctgcattacaggcactaaagagaaagaagaggttcgagaaacagctcact
cagattgatggcacactttctaccattgagttccagagagaagccctggagaactcacac
accaacactgaggtgttgaggaacatgggctttgcagcaaaagcgatgaaatctgttcat
gaaaacatggatctgaacaaaatagatgatttgatgcaagagatcacagagcaacaggat
atcgcccaagaaatctcagaagcattttctcaacgggttggctttggtgatgactttgat
gaggatgagttgatggcagaacttgaagaattggaacaggaggaattaaataagaagatg
acaaatatccgccttccaaatgtgccttcctcttctctcccagcacagccaaatagaaaa
ccaggcatgtcgtccactgcacgtcgatcccgagcagcatcttcccagagggcagaagaa
gaggatgatgatatcaaacaattggcagcttgggctacctaa

DBGET integrated database retrieval system