KEGG   Homo sapiens (human): 9244
Entry
9244              CDS       T01001                                 
Symbol
CRLF1, CISS, CISS1, CLF, CLF-1, NR6, zcytor5
Name
(RefSeq) cytokine receptor like factor 1
  KO
K24481  cytokine receptor-like factor 1
Organism
hsa  Homo sapiens (human)
Disease
H00935  Cold-induced sweating syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9244 (CRLF1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   9244 (CRLF1)
SSDB
Motif
Pfam: fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N Lep_receptor_Ig ObR_Ig Interfer-bind Ig_3
Other DBs
NCBI-GeneID: 9244
NCBI-ProteinID: NP_004741
OMIM: 604237
HGNC: 2364
Ensembl: ENSG00000006016
Pharos: O75462(Tbio)
UniProt: O75462
Position
19:complement(18593237..18606799)
AA seq 422 aa
MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATC
SVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARD
GSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQ
DNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPD
VHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAG
LKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSS
GPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGP
AR
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgcccgccggccgccggggccccgccgcccaatccgcgcggcggccgccgccgttgctg
cccctgctgctgctgctctgcgtcctcggggcgccgcgagccggatcaggagcccacaca
gctgtgatcagtccccaggatcccacgcttctcatcggctcctccctgctggccacctgc
tcagtgcacggagacccaccaggagccaccgccgagggcctctactggaccctcaacggg
cgccgcctgccccctgagctctcccgtgtactcaacgcctccaccttggctctggccctg
gccaacctcaatgggtccaggcagcggtcgggggacaacctcgtgtgccacgcccgtgac
ggcagcatcctggctggctcctgcctctatgttggcctgcccccagagaaacccgtcaac
atcagctgctggtccaagaacatgaaggacttgacctgccgctggacgccaggggcccac
ggggagaccttcctccacaccaactactccctcaagtacaagcttaggtggtatggccag
gacaacacatgtgaggagtaccacacagtggggccccactcctgccacatccccaaggac
ctggctctctttacgccctatgagatctgggtggaggccaccaaccgcctgggctctgcc
cgctccgatgtactcacgctggatatcctggatgtggtgaccacggaccccccgcccgac
gtgcacgtgagccgcgtcgggggcctggaggaccagctgagcgtgcgctgggtgtcgcca
cccgccctcaaggatttcctctttcaagccaaataccagatccgctaccgagtggaggac
agtgtggactggaaggtggtggacgatgtgagcaaccagacctcctgccgcctggccggc
ctgaaacccggcaccgtgtacttcgtgcaagtgcgctgcaacccctttggcatctatggc
tccaagaaagccgggatctggagtgagtggagccaccccacagccgcctccactccccgc
agtgagcgcccgggcccgggcggcggggcgtgcgaaccgcggggcggagagccgagctcg
gggccggtgcggcgcgagctcaagcagttcctgggctggctcaagaagcacgcgtactgc
tccaacctcagcttccgcctctacgaccagtggcgagcctggatgcagaagtcgcacaag
acccgcaaccaggacgaggggatcctgccctcgggcagacggggcacggcgagaggtcct
gccagataa

DBGET integrated database retrieval system