KEGG   Homo sapiens (human): 9246
Entry
9246              CDS       T01001                                 

Gene name
UBE2L6, RIG-B, UBCH8
Definition
(RefSeq) ubiquitin conjugating enzyme E2 L6
  KO
K04553  ubiquitin-conjugating enzyme E2 L6 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06463  Parkinson disease
  Element
N01019  Parkin-mediated ubiquitination
N01020  Mutation-inactivated PRKN to Parkin-mediated ubiquitination
N01021  Parkin-mediated ubiquitination
N01022  Mutation-inactivated PRKN to Parkin-mediated ubiquitination
N01023  Parkin-mediated ubiquitination
N01024  Mutation-inactivated PRKN to Parkin-mediated ubiquitination
N01025  Parkin-mediated ubiquitination
N01026  Mutation-inactivated PRKN to Parkin-mediated ubiquitination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9246 (UBE2L6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    9246 (UBE2L6)
   05022 Pathways of neurodegeneration - multiple diseases
    9246 (UBE2L6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9246 (UBE2L6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     9246 (UBE2L6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   9246 (UBE2L6)
  UBL-conjugating enzymes
   9246 (UBE2L6)
SSDB
Motif
Pfam: UQ_con RWD UEV Prok-E2_B
Other DBs
NCBI-GeneID: 9246
NCBI-ProteinID: NP_004214
OMIM: 603890
HGNC: 12490
Ensembl: ENSG00000156587
Vega: OTTHUMG00000167047
Pharos: O14933(Tbio)
UniProt: O14933
Structure
PDB: 
1WZV 1WZW 2KJH

Position
11q12.1
AA seq 153 aa
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPE
YPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREP
LRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgatggcgagcatgcgagtggtgaaggagctggaggatcttcagaagaagcctccccca
tacctgcggaacctgtccagcgatgatgccaatgtcctggtgtggcacgctctcctccta
cccgaccaacctccctaccacctgaaagccttcaacctgcgcatcagcttcccgccggag
tatccgttcaagcctcccatgatcaaattcacaaccaagatctaccaccccaacgtggac
gagaacggacagatttgcctgcccatcatcagcagtgagaactggaagccttgcaccaag
acttgccaagtcctggaggccctcaatgtgctggtgaatagaccgaatatcagggagccc
ctgcggatggacctcgctgacctgctgacacagaatccggagctgttcagaaagaatgcc
gaagagttcaccctccgattcggagtggaccggccctcctaa

DBGET integrated database retrieval system