KEGG   Homo sapiens (human): 9248Help
Entry
9248              CDS       T01001                                 

Gene name
GPR50, H9, Mel1c
Definition
(RefSeq) G protein-coupled receptor 50
  KO
K04287  G protein-coupled receptor 50
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9248 (GPR50)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9248 (GPR50)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    9248 (GPR50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 9248
NCBI-ProteinID: NP_004215
OMIM: 300207
HGNC: 4506
Ensembl: ENSG00000102195
Vega: OTTHUMG00000024166
Pharos: Q13585(Tbio)
UniProt: Q13585
Position
Xq28
AA seq 617 aa AA seqDB search
MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLR
NSGNIFVVSLSVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIV
AIAINRYCYICHSLQYERIFSVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIF
NYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAARDPAGQNPDNQLAEVRNFLTMF
VIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYFIAYFNSCLNAVIYGLLNEN
FRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQDRAHACPAVEE
TPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP
VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGH
HVSAGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELS
ASHCPEIPAIAHPVSDDSDLPESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDY
HDVVVIDVEDDPDEMAV
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggggcccaccctagcggttcccaccccctatggctgtattggctgtaagctaccccag
ccagaatacccaccggctctaatcatctttatgttctgcgcgatggttatcaccatcgtt
gtagacctaatcggcaactccatggtcattttggctgtgacgaagaacaagaagctccgg
aattctggcaacatcttcgtggtcagtctctctgtggccgatatgctggtggccatctac
ccataccctttgatgctgcatgccatgtccattgggggctgggatctgagccagttacag
tgccagatggtcgggttcatcacagggctgagtgtggtcggctccatcttcaacatcgtg
gcaatcgctatcaaccgttactgctacatctgccacagcctccagtacgaacggatcttc
agtgtgcgcaatacctgcatctacctggtcatcacctggatcatgaccgtcctggctgtc
ctgcccaacatgtacattggcaccatcgagtacgatcctcgcacctacacctgcatcttc
aactatctgaacaaccctgtcttcactgttaccatcgtctgcatccacttcgtcctccct
ctcctcatcgtgggtttctgctacgtgaggatctggaccaaagtgctggcggcccgtgac
cctgcagggcagaatcctgacaaccaacttgctgaggttcgcaattttctaaccatgttt
gtgatcttcctcctctttgcagtgtgctggtgccctatcaacgtgctcactgtcttggtg
gctgtcagtccgaaggagatggcaggcaagatccccaactggctttatcttgcagcctac
ttcatagcctacttcaacagctgcctcaacgctgtgatctacgggctcctcaatgagaat
ttccgaagagaatactggaccatcttccatgctatgcggcaccctatcatattcttctct
ggcctcatcagtgatattcgtgagatgcaggaggcccgtaccctggcccgcgcccgtgcc
catgctcgcgaccaagctcgtgaacaagaccgtgcccatgcctgtcctgctgtggaggaa
accccgatgaatgtccggaatgttccattacctggtgatgctgcagctggccaccccgac
cgtgcctctggccaccctaagccccattccagatcctcctctgcctatcgcaaatctgcc
tctacccaccacaagtctgtctttagccactccaaggctgcctctggtcacctcaagcct
gtctctggccactccaagcctgcctctggtcaccccaagtctgccactgtctaccctaag
cctgcctctgtccatttcaaggctgactctgtccatttcaagggtgactctgtccatttc
aagcctgactctgttcatttcaagcctgcttccagcaaccccaagcccatcactggccac
catgtctctgctggcagccactccaagtctgccttcagtgctgccaccagccaccctaaa
cccaccactggccacatcaagccagctaccagccatgctgagcccaccactgctgactat
cccaagcctgccactaccagccaccctaagcccactgctgctgacaaccctgagctctct
gcctcccattgccccgagatccctgccattgcccaccctgtgtctgacgacagtgacctc
cctgagtcggcctctagccctgccgctgggcccaccaagcctgctgccagccagctggag
tctgacaccatcgctgaccttcctgaccctactgtagtcactaccagtaccaatgattac
catgatgtcgtggttattgatgttgaagatgatcctgatgaaatggctgtgtga

DBGET integrated database retrieval system