KEGG   Homo sapiens (human): 9249Help
Entry
9249              CDS       T01001                                 

Gene name
DHRS3, DD83.1, RDH17, Rsdr1, SDR1, SDR16C1, retSDR1
Definition
(RefSeq) dehydrogenase/reductase 3
  KO
K11146  short-chain dehydrogenase/reductase 3 [EC:1.1.1.300]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    9249 (DHRS3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     9249 (DHRS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Shikimate_DH Epimerase Sacchrp_dh_NADP PTH2
Motif
Other DBs
NCBI-GeneID: 9249
NCBI-ProteinID: NP_004744
OMIM: 612830
HGNC: 17693
Ensembl: ENSG00000162496
Vega: OTTHUMG00000001885
Pharos: O75911(Tbio)
UniProt: O75911
Position
1p36.21
AA seq 302 aa AA seqDB search
MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE
RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL
VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS
AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP
LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG
RT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggtgtggaaacggctgggcgcgctggtgatgttccctctacagatgatctatctggtg
gtgaaagcagccgtcggactggtgctgcccgccaagctgcgggacctgtcgcgggagaac
gtcctcatcaccggcggcgggagaggcatcgggcgtcagctcgcccgcgagttcgcggag
cgcggcgccagaaagattgttctctggggccggactgagaaatgcctgaaggagacgacg
gaggagatccggcagatgggcactgagtgccattacttcatctgtgatgtgggcaaccgg
gaggaggtgtaccagacggccaaggccgtccgggagaaggtgggtgacatcaccatcctg
gtgaacaatgccgccgtggtccatgggaagagcctaatggacagtgatgatgatgccctc
ctcaagtcccaacacatcaacaccctgggccagttctggaccaccaaggccttcctgccg
cgtatgctggagctgcagaatggccacatcgtgtgcctcaactccgtgctggcactgtct
gccatccccggtgccatcgactactgcacatccaaagcgtcagccttcgccttcatggag
agcctgaccctggggctgctggactgtccgggagtcagcgccaccacagtgctgcccttc
cacaccagcaccgagatgttccagggcatgagagtcaggtttcccaacctctttccccca
ctgaagccggagacggtggcccggaggacagtggaagctgtgcagctcaaccaggccctc
ctcctcctcccatggacaatgcatgccctcgttatcttgaaaagcatacttccacaggct
gcactcgaggagatccacaaattctcaggaacctacacctgcatgaacactttcaaaggg
cggacatag

DBGET integrated database retrieval system