KEGG   Homo sapiens (human): 925Help
Entry
925               CDS       T01001                                 

Gene name
CD8A, CD8, Leu2, p32
Definition
(RefSeq) CD8a molecule
  KO
K06458  T-cell surface glycoprotein CD8 alpha chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04660  T cell receptor signaling pathway
hsa05340  Primary immunodeficiency
Disease
H00093  Combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    925 (CD8A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    925 (CD8A)
   04612 Antigen processing and presentation
    925 (CD8A)
   04660 T cell receptor signaling pathway
    925 (CD8A)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    925 (CD8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    925 (CD8A)
CD molecules [BR:hsa04090]
 Proteins
  925 (CD8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2
Motif
Other DBs
NCBI-GeneID: 925
NCBI-ProteinID: NP_001139345
OMIM: 186910
HGNC: 1706
Ensembl: ENSG00000153563
Vega: OTTHUMG00000130265
Pharos: P01732(Tbio)
UniProt: P01732 Q8TAW8 Q6ZVS2
Structure
PDB: 

Position
2p11.2
AA seq 235 aa AA seqDB search
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccagg
ccgagccagttccgggtgtcgccgctggatcggacctggaacctgggcgagacagtggag
ctgaagtgccaggtgctgctgtccaacccgacgtcgggctgctcgtggctcttccagccg
cgcggcgccgccgccagtcccaccttcctcctatacctctcccaaaacaagcccaaggcg
gccgaggggctggacacccagcggttctcgggcaagaggttgggggacaccttcgtcctc
accctgagcgacttccgccgagagaacgagggctactatttctgctcggccctgagcaac
tccatcatgtacttcagccacttcgtgccggtcttcctgccagcgaagcccaccacgacg
ccagcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagcccctgtccctgcgc
ccagaggcgtgccggccagcggcggggggcgcagtgcacacgagggggctggacttcgcc
tgtgatatctacatctgggcgcccttggccgggacttgtggggtccttctcctgtcactg
gttatcaccctttactgcaaccacaggaaccgaagacgtgtttgcaaatgtccccggcct
gtggtcaaatcgggagacaagcccagcctttcggcgagatacgtctaa

DBGET integrated database retrieval system