KEGG   Homo sapiens (human): 92521
Entry
92521             CDS       T01001                                 
Symbol
SPECC1, CYTSB, HCMOGT-1, HCMOGT1, NSP, NSP5
Name
(RefSeq) sperm antigen with calponin homology and coiled-coil domains 1
  KO
K23028  cytospin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    92521 (SPECC1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     92521 (SPECC1)
SSDB
Motif
Pfam: CH Fez1 DUF4200 CAMSAP_CH HMMR_N DUF641
Other DBs
NCBI-GeneID: 92521
NCBI-ProteinID: NP_001028725
OMIM: 608793
HGNC: 30615
Ensembl: ENSG00000128487
UniProt: Q5M775 B4E2A4 B4DW07
Position
17:20009359..20319026
AA seq 1068 aa
MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLN
KPGSTAASGVVRLKKTATAGAISELTESRLRSGTGAFTTTKRTGIPAPREFSVTVSRERS
VPRGPSNPRKSVSSPTSSNTPTPTKHLRTPSTKPKQENEGGEKAALESQVRELLAEAKAK
DSEINRLRSELKKYKEKRTLNAEGTDALGPNVDGTSVSPGDTEPMIRALEEKNKNFQKEL
SDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSDIDEY
KKNIHGNALRTSGSSSSDVTKASLSPDASDFEHITAETPSRPLSSTSNPFKSSKCSTAGS
SPNSVSELSLASLTEKIQKMEENHHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKT
ILETSFHQHRERAEQLSQENEKLMNLLQERVKNEEPTTQEGKIIELEQKCTGILEQGRFE
REKLLNIQQQLTCSLRKVEEENQGALEMIKRLKEENEKLNEFLELERHNNNMMAKTLEEC
RVTLEGLKMENGSLKSHLQGEKQKATEASAVEQTAESCEVQEMLKVARAEKDLLELSCNE
LRQELLKANGEIKHVSSLLAKVEKDYSYLKEICDHQAEQLSRTSLKLQEKASESDAEIKD
MKETIFELEDQVEQHRAVKLHNNQLISELESSVIKLEEQKSDLERQLKTLTKQMKEETEE
WRRFQADLQTAVVVANDIKCEAQQELRTVKRKLLEEEEKNARLQKELGDVQGHGRVVTSR
AAPPPVDEEPESSEVDAAGRWPGVCVSRTSPTPPESATTVKSLIKSFDLGRPGGAGQNIS
VHKTPRSPLSGIPVRTAPAAAVSPMQRHSTYSSVRPASRGVTQRLDLPDLPLSDILKGRT
ETLKPDPHLRKSPSLESLSRPPSLGFGDTRLLSASTRAWKPQSKLSVERKDPLAALAREY
GGSKRNALLKWCQKKTQGYANIDITNFSSSWSDGLAFCALLHTYLPAHIPYQELNSQEKK
RNLLLAFEAAESVGIKPSLELSEMLYTDRPDWQSVMQYVAQIYKYFET
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcggagtgcagccaagccctggaacccagccatcagagcagggggccacggcccagac
cgggtgcggcctctgcctgcagcctcttccggcatgaagagttctaagtcttcaacttcc
ttggcttttgagtcccgactcagcaggctcaagagggccagcagtgaggacacgctcaac
aagccaggaagtaccgctgcatcgggggtggttcgcctgaagaagaccgccactgccgga
gccatctcggagctcacggagagccgcctgaggagcggcacaggggcctttacaacaact
aaacggacaggcattccagccccacgggaattttcagtaactgtctcaagagagaggtct
gtgccacgtggtccctccaaccccaggaaatcagtgtccagtccaacttcttccaacact
cccactcctacgaaacacctgaggaccccttccacaaagcccaagcaagagaatgaaggt
ggagaaaaggctgcgcttgagtcccaagttcgggaacttttggcagaagccaaagcaaaa
gatagtgaaattaacaggcttcgaagtgaactaaagaaatacaaagagaaaaggactctg
aacgctgaggggactgatgctttgggcccaaatgtcgatggaacatcagtctccccaggt
gacacggaacctatgataagagctcttgaggagaagaacaagaactttcagaaagagctt
tccgatctagaggaagaaaaccgggtcctgaaggagaaactgatctatcttgagcactcc
ccaaattcagaaggggcagcaagtcacactggcgacagcagctgcccaacatccataact
caagagtcaagcttcggaagcccaactggaaatcagatgtccagtgacattgatgagtat
aaaaaaaacatacatggaaatgcattacggacatcaggctcctcaagtagcgatgttacc
aaagcttctttgtcgccagatgcttccgactttgagcacattacagcagagacaccctca
aggcccctgtcctccaccagtaacccctttaagagttcaaagtgttctactgctgggagt
tccccaaacagcgtaagtgaattgtccctggcttccctcacagagaagatacaaaagatg
gaagaaaaccaccatagcactgcagaagaactacaggctactctacaagaattatcagac
cagcaacaaatggtacaggaattgacagctgaaaatgagaagctggtggatgaaaagacg
attttagagacatcctttcatcagcatcgagagagggcagagcagctaagtcaagaaaat
gagaagctgatgaatcttttacaagagcgagtaaagaatgaagagcccaccactcaggaa
ggaaaaattattgaactggagcagaagtgcacaggtattcttgaacagggccgctttgaa
agagagaagctactcaacattcagcagcagttgacctgtagcttgcggaaggttgaggaa
gaaaaccaaggagctttagaaatgattaaacgtctgaaggaagaaaatgaaaaactgaat
gagtttctagaactggaacggcataataataacatgatggccaaaactttggaagagtgt
agagttaccttggaagggctaaaaatggagaatggatctttgaagtctcatttgcagggt
gagaagcagaaagccacagaggccagtgctgtggagcagacggcagagagctgcgaagtt
caagaaatgttgaaagtagcccgagcagagaaagatctactggaactgtcttgcaatgag
ctcagacaagaattactaaaggcaaacggtgaaattaaacatgtttccagtctgctggcc
aaggtggaaaaggattattcatacctgaaggagatatgtgatcaccaagccgaacagctg
agcagaaccagcctaaagctgcaagaaaaagcatcagagagtgatgcagagatcaaagac
atgaaagaaaccatatttgaattggaagatcaggtggaacagcaccgggctgtcaagtta
cacaataatcaactcatcagtgagctagaaagtagtgtgatcaagctggaggaacagaag
tcagacctggagaggcagctgaagactctgaccaagcagatgaaggaggagaccgaggaa
tggaggcggttccaggcggatctgcagaccgcagtggtggtggccaatgacatcaagtgt
gaggcccagcaggagctgcgcaccgtgaagaggaaactgctggaggaggaggagaagaat
gcccggttgcagaaggagctgggggatgtgcagggccacggcagggtggtcaccagcaga
gccgcccctccacctgtggatgaagagccagagtcctctgaggtcgatgctgctggtcgg
tggcctggtgtctgtgttagcagaacatctccaacacccccagagtcggcaaccaccgtt
aagtcacttatcaagtcatttgacttgggacgcccaggtggagctggacagaatatttct
gtccataagacccccagaagtcccctaagtgggataccagtgaggactgctccagcagct
gctgtctctccaatgcagaggcattcgacttacagcagtgtgcggccagccagcagaggg
gtgactcaacgcttggaccttcctgaccttcccctctcagatattctaaagggaaggact
gagaccctgaagccagacccccacctccgcaagagtccctcactagagtcactgagcaga
cccccgtctctgggctttggggacacaagactgctgagtgcttccacccgggcatggaaa
ccacaaagcaaactcagtgtggaaagaaaagaccctctggcagccttggcccgggaatac
ggtggttccaagcgcaatgctctactgaaatggtgccagaagaagacacaaggttatgcg
aacattgacatcaccaatttcagcagcagctggagcgatggcctggccttctgtgctctg
ctccacacctacctgcctgcccacatcccctaccaggagctgaatagtcaggagaaaaag
aggaatctcttgttggcatttgaagcggctgaaagtgtaggcatcaaacccagcctggaa
ctcagcgagatgctgtacacagaccggcccgactggcagagtgtgatgcagtacgtggcc
caaatctacaagtactttgagacgtaa

DBGET integrated database retrieval system