KEGG   Homo sapiens (human): 9253Help
Entry
9253              CDS       T01001                                 

Gene name
NUMBL, CAG3A, CTG3a, NBL, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Definition
(RefSeq) NUMB like, endocytic adaptor protein
  KO
K06057  numb
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    9253 (NUMBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9253 (NUMBL)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    9253 (NUMBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NumbF PID PTB PID_2 DUF2722 DUF1932 Rrn6 Suf
Motif
Other DBs
NCBI-GeneID: 9253
NCBI-ProteinID: NP_004747
OMIM: 604018
HGNC: 8061
Ensembl: ENSG00000105245
Vega: OTTHUMG00000182627
Pharos: Q9Y6R0(Tbio)
UniProt: Q9Y6R0 A8K033
Structure
PDB: 

Position
19q13.2
AA seq 609 aa AA seqDB search
MSRSAAASGGPRRPERHLPPAPCGAPGPPETCRTEPDGAGTMNKLRQSLRRRKPAYVPEA
SRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWV
SADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDS
GERLSHAVGCAFAACLERKQRREKECGVTAAFDASRTSFAREGSFRLSGGGRPAEREAPD
KKKAEAAAAPTVAPGPAQPGHVSPTPATTSPGEKGEAGTPVAAGTTAAAIPRRHAPLEQL
VRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSI
NALCTQISSSFASAGAPAPGPPPATTGTSAWGEPSVPPAAAFQPGHKRTPSEAERWLEEV
SQVAKAQQQQQQQQQQQQQQQQQQQQAASVAPVPTMPPALQPFPAPVGPFDAAPAQVAVF
LPPPHMQPPFVPAYPGLGYPPMPRVPVVGITPSQMVANAFCSAAQLQPQPATLLGKAGAF
PPPAIPSAPGSQARPRPNGAPWPPEPAPAPAPELDPFEAQWAALEGKATVEKPSNPFSGD
LQKTFEIEL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcagcgcggcggccagcggcggaccccggaggcctgagcggcacctgccccca
gccccctgtggggccccggggcccccagaaacctgcaggacggagccagacggggcgggc
accatgaacaagttacggcagagcctgcggcggaggaagccagcctacgtgcccgaggcg
tcgcgcccgcaccagtggcaggcagacgaggacgcggtgcggaagggcacgtgcagcttc
ccggtcaggtacctgggtcacgtggaggtagaggagtcccggggaatgcacgtgtgtgaa
gatgcggtgaagaagctgaaggcgatgggccgaaagtccgtgaagtctgtcctgtgggtg
tcagccgatgggctccgagtggtggacgacaaaaccaaggatcttctggtcgaccagacc
atcgaaaaggtctccttttgtgctcctgaccgcaacctggacaaggctttctcctatatc
tgtcgtgacgggactacccgccgctggatctgccactgttttctggcactgaaggactcc
ggcgagaggctgagccacgctgtgggctgtgcttttgccgcctgcctggagcgaaaacag
cgacgggagaaggaatgtggggtcacggccgccttcgatgccagccgcaccagcttcgcc
cgcgagggctccttccgcctgtctgggggtgggcggcctgctgagcgagaggccccggac
aagaagaaagcagaggcagcagctgcccccactgtggctcctggccctgcccagcctggg
cacgtgtccccgacaccagccaccacatcccctggtgagaagggtgaggcaggcacccct
gtggctgcaggcaccactgcggccgccatcccccggcgccatgcacccctggagcagctg
gttcgccagggctccttccgtgggttcccagcactcagccagaagaactcgcctttcaaa
cggcagctgagcctacggctgaatgagctgccatccacgctgcagcgccgcactgacttc
caggtgaagggcacagtgcctgagatggagcctcctggtgccggcgacagtgacagcatc
aacgctctgtgcacacagatcagttcatcttttgccagtgctggagcgccagcaccaggg
ccaccacctgccacaacagggacttctgcctggggtgagccctccgtgccccctgcagct
gccttccagcctgggcacaagcggacaccttcagaggctgagcgatggctggaggaggtg
tcacaggtggccaaggcccagcagcagcagcagcagcaacagcaacagcagcagcagcag
cagcagcaacagcagcaagcagcctcagtggccccagtgcccaccatgcctcctgccctg
cagcctttccccgcccccgtggggccctttgacgctgcacctgcccaagtggccgtgttc
ctgccacccccacacatgcagcccccttttgtgcccgcctacccgggcttgggctaccca
ccgatgccccgggtgcccgtggtgggcatcacaccctcacagatggtggcaaacgccttc
tgctcagccgcccagctccagcctcagcctgccactctgcttgggaaagctggggccttc
ccgccccctgccatacccagtgcccctgggagccaggcccgccctcgccccaatggggcc
ccctggccccctgagccagcgcctgccccagctccagagttggacccctttgaggcccag
tgggcggcattagaaggcaaagccactgtagagaaaccctccaaccccttttctggcgac
ctgcaaaagacattcgagattgaactgtag

DBGET integrated database retrieval system