KEGG   Homo sapiens (human): 9255Help
Entry
9255              CDS       T01001                                 

Gene name
AIMP1, EMAP2, EMAPII, HLD3, SCYE1, p43
Definition
(RefSeq) aminoacyl tRNA synthetase complex interacting multifunctional protein 1
  KO
K15437  aminoacyl tRNA synthase complex-interacting multifunctional protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    9255 (AIMP1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    9255 (AIMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_bind NUDE_C
Motif
Other DBs
NCBI-GeneID: 9255
NCBI-ProteinID: NP_001135887
OMIM: 603605
HGNC: 10648
Ensembl: ENSG00000164022
Vega: OTTHUMG00000131217
Pharos: Q12904(Tbio)
UniProt: Q12904 B4DNK3
Structure
PDB: 

Position
4q24
AA seq 312 aa AA seqDB search
MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKEIE
ELKQELIQAEIQNGVKQIPFPSGTPLHANSMVSENVIQSTAVTTVSSGTKEQIKGGTGDE
KKAKEKIEKKGEKKEKKQQSIAGSADSKPIDVSRLDLRIGCIITARKHPDADSLYVEEVD
VGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILA
PPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGV
CRAQTMSNSGIK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataatgatgctgttctgaagagactggagcagaagggtgcagaggcagatcaa
atcattgaatatcttaagcagcaagtttctctacttaaggagaaagcaattttgcaggca
actttgagggaagagaagaaacttcgagttgaaaatgctaaactgaagaaagaaattgaa
gaactgaaacaagagctaattcaggcagaaattcaaaatggagtgaagcaaataccattt
ccatctggtactccactgcacgctaattctatggtttctgaaaatgtgatacagtctaca
gcagtaacaaccgtatcttctggtaccaaagaacagataaaaggaggaacaggagacgaa
aagaaagcgaaagagaaaattgaaaagaaaggagagaagaaggagaaaaaacagcaatca
atagctggaagtgccgactctaagccaatagatgtttcccgtctggatcttcgaattggt
tgcatcataactgctagaaaacaccctgatgcagattctttgtatgtggaagaagtagat
gtcggagaaatagccccaaggacagttgtcagtggcctggtgaatcatgttcctcttgaa
cagatgcaaaatcggatggtgattttactttgtaacctgaaacctgcaaagatgagggga
gtattatctcaagcaatggtcatgtgtgctagttcaccagagaaaattgaaatcttggct
cctccaaatgggtctgttcctggagacagaattacttttgatgctttcccaggagagcct
gacaaggagctgaatcctaagaagaagatttgggagcagatccagcctgatcttcacact
aatgatgagtgtgtggctacatacaaaggagttccctttgaggtgaaagggaagggagta
tgtagggctcaaaccatgagcaacagtggaatcaaataa

DBGET integrated database retrieval system