KEGG   Homo sapiens (human): 9256Help
Entry
9256              CDS       T01001                                 

Gene name
TSPOAP1, BZRAP1, PBR-IP, PRAX-1, PRAX1, RIM-BP1, RIMBP1
Definition
(RefSeq) TSPO associated protein 1
  KO
K19922  peripheral-type benzodiazepine receptor-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9256 (TSPOAP1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    9256 (TSPOAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_2 SH3_9 SH3_1
Motif
Other DBs
NCBI-GeneID: 9256
NCBI-ProteinID: NP_004749
OMIM: 610764
HGNC: 16831
Ensembl: ENSG00000005379
Vega: OTTHUMG00000178923
Pharos: O95153(Tbio)
UniProt: O95153 A7E2C5 B7ZVZ7 B2RUT8
Position
17q22
AA seq 1857 aa AA seqDB search
MEQLTTLPRPGDPGAMEPWALPTWHSWTPGRGGEPSSAAPSIADTPPAALQLQELRSEES
SKPKGDGSSRPVGGTDPEGAEACLPSLGQQASSSGPACQRPEDEEVEAFLKAKLNMSFGD
RPNLELLRALGELRQRCAILKEENQMLRKSSFPETEEKVRRLKRKNAELAVIAKRLEERA
RKLQETNLRVVSAPLPRPGTSLELCRKALARQRARDLSETASALLAKDKQIAALQRECRE
LQARLTLVGKEGPQWLHVRDFDRLLRESQREVLRLQRQIALRNQRETLPLPPSWPPGPAL
QARAGAPAPGAPGEATPQEDADNLPVILGEPEKEQRVQQLESELSKKRKKCESLEQEARK
KQRRCEELELQLRQAQNENARLVEENSRLSGRATEKEQVEWENAELRGQLLGVTQERDSA
LRKSQGLQSKLESLEQVLKHMREVAQRRQQLEVEHEQARLSLREKQEEVRRLQQAQAEAQ
REHEGAVQLLESTLDSMQARVRELEEQCRSQTEQFSLLAQELQAFRLHPGPLDLLTSALD
CGSLGDCPPPPCCCSIPQPCRGSGPKDLDLPPGSPGRCTPKSSEPAPATLTGVPRRTAKK
AESLSNSSHSESIHNSPKSCPTPEVDTASEVEELEADSVSLLPAAPEGSRGGARIQVFLA
RYSYNPFEGPNENPEAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSD
DDLLTSLPPELADLSHSSGPELSFLSVGGGGSSSGGQSSVGRSQPRPEEEDAGDELSLSP
SPEGLGEPPAVPYPRRLVVLKQLAHSVVLAWEPPPEQVELHGFHICVNGELRQALGPGAP
PKAVLENLDLWAGPLHISVQALTSRGSSDPLRCCLAVGARAGVVPSQLRVHRLTATSAEI
TWVPGNSNLAHAIYLNGEECPPASPSTYWATFCHLRPGTPYQAQVEAQLPPQGPWEPGWE
RLEQRAATLQFTTLPAGPPDAPLDVQIEPGPSPGILIISWLPVTIDAAGTSNGVRVTGYA
IYADGQKIMEVASPTAGSVLVELSQLQLLQVCREVVVRTMSPHGESADSIPAPITPALAP
ASLPARVSCPSPHPSPEARAPLASASPGPGDPSSPLQHPAPLGTQEPPGAPPASPSREMA
KGSHEDPPAPCSQEEAGAAVLGTSEERTASTSTLGEKDPGPAAPSLAKQEAEWTAGEACP
ASSSTQGARAQQAPNTEMCQGGDPGSGLRPRAEKEDTAELGVHLVNSLVDHGRNSDLSDI
QEEEEEEEEEEEEELGSRTCSFQKQVAGNSIRENGAKSQPDPFCETDSDEEILEQILELP
LQQFCSKKLFSIPEEEEEEEEDEEEEKSGAGCSSRDPGPPEPALLGLGCDSGQPRRPGQC
PLSPESSRAGDCLEDMPGLVGGSSRRRGGGSPEKPPSRRRPPDPREHCSRLLSNNGPQAS
GRLGPTRERGGLPVIEGPRTGLEASGRGRLGPSRRCSRGRALEPGLASCLSPKCLEISIE
YDSEDEQEAGSGGISITSSCYPGDGEAWGTATVGRPRGPPKANSGPKPYPRLPAWEKGEP
ERRGRSATGRAKEPLSRATETGEARGQDGSGRRGPQKRGVRVLRPSTAELVPARSPSETL
AYQHLPVRIFVALFDYDPVSMSPNPDAGEEELPFREGQILKVFGDKDADGFYQGEGGGRT
GYIPCNMVAEVAVDSPAGRQQLLQRGYLSPDILLEGSGNGPFVYSTAHTTGPPPKPRRSK
KAESEGPAQPCPGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDVEAELPFRAGDVITV
FGGMDDDGFYYGELNGQRGLVPSNFLEGPGPEAGGLDREPRTPQAESQRTRRRRVQC
NT seq 5574 nt NT seq  +upstreamnt  +downstreamnt
atggagcaactgacaaccctcccacggcctggggaccctggagccatggagccatgggca
ctgcccacctggcatagctggactccaggtcgagggggtgaacctagcagtgcagcccca
agcatcgctgatactcctccggcagctctgcagcttcaagaactgaggtctgaggagagt
tccaagcccaaaggagacgggagctccaggcccgtggggggaactgaccctgaaggagca
gaggcttgtctgcccagcctgggccagcaagcatccagctctggacccgcctgccagagg
ccagaggatgaggaagtggaggctttcctgaaggccaagctgaatatgagctttggggac
aggcccaatctggagctgctgagggccctgggggagctgcggcagcgctgtgccatcctt
aaggaggaaaaccagatgctgaggaagagcagcttccctgagacagaagagaaggtgcgg
aggctgaagaggaagaacgccgagctggcggtcattgccaagcgcctggaggagagggcc
cgaaagctgcaggaaacgaacctgagggtggtgagtgcccccttgccccggccggggacc
agcttggagttgtgtcggaaggccctagcccgccagcgagcccgggacctcagtgagaca
gccagtgcactgctggccaaggacaagcagattgctgccttgcagcgggagtgcagggag
ctgcaggccaggctcactctggtgggcaaggagggtccccagtggctccacgtgcgggac
ttcgatcggctgctgcgcgagtcccagcgggaggtgctgcggctgcagaggcagatcgcg
ctgcgcaaccagcgggagacgctcccgctcccgccgtcctggcccccgggccctgctctc
caggccagagcaggggcgcctgctcccggggccccgggagaggccacgccccaggaggat
gcggacaacctacccgtgattctaggggagccagagaaagagcagagggtgcagcagctg
gaatcggagctcagcaagaagcggaagaaatgcgagagcctggagcaggaagcccggaaa
aagcagaggcgatgtgaggagctggaactgcagctgagacaagcgcagaatgagaatgcc
cgcctggtggaggagaactcccggctcagtgggagagccacagagaaggagcaggtggag
tgggagaatgcggagctgaggggccagctcctgggggtgacacaggagagggactcagcc
cttcgcaagagccagggcctgcagagcaagctggagagcctggagcaagtgctgaagcac
atgcgggaggtggcccagcggcggcagcagctggaggtggagcatgaacaggctcggctc
agcctacgggagaagcaggaggaggtccggagactgcagcaggcccaggctgaagcccag
agggaacatgaaggagccgtgcagctgctggagtctaccttggattccatgcaggcccgg
gttcgagagctcgaagaacagtgccgcagccaaaccgagcagttcagcctcctggcacag
gaactccaggctttccgcctgcacccgggccccttggatctgctcacatctgccctggac
tgtgggagccttggagactgcccaccacccccctgctgctgctccattccccagccttgc
cgggggtctggccccaaagaccttgacctcccgccgggctcccctgggcgctgcacccca
aagtcttccgagcctgcccctgccactctcactggggtccctcgaaggacagccaagaag
gcagagtctctctccaactcctcccactccgagtccatccacaacagccccaagtcatgc
cctacacctgaggtggacacagccagtgaggtagaggagctggaggcagacagtgtctcc
ctgctcccagctgcgccagagggcagccggggaggagccaggatccaggtcttcctagca
cgttatagctacaacccctttgagggtcccaatgagaatccagaagcagagcttccgctg
acagctggcgagtacatctacatctatggcaacatggatgaggatggcttttttgaagga
gagctcatggatggccgaaggggcctggtcccttccaattttgtagagcgtgtgtcggat
gatgacctcctgacctccctccctccagagctggccgatttgtcccacagctcaggccct
gaactcagtttcctgagtgtaggtgggggtggcagcagtagcgggggccaaagcagtgtg
ggaaggagccagcccagacctgaggaggaggatgcaggggacgagctcagtctgagccca
tcaccggagggcctgggcgagcctcctgccgtgccttacccccgccgtctggtggtcctc
aagcagctggcccacagcgtggtgctggcctgggagccgcctcctgagcaagtggagcta
cacggcttccatatctgtgtgaatggggagctgcgacaggccctggggcctggggcgcca
cccaaggccgtgctggagaacctggacctgtgggccgggccccttcacatttctgtccag
gccctgactagccggggcagctctgacccactgcgctgttgcttggcggtgggtgcccgg
gccggagtggtgcccagccagctgcgggtccatcggttgacagccacatctgctgagatc
acctgggtgcccggcaatagcaacttggcccatgccatctacctcaatggggaagagtgc
ccacctgccagccccagtacctactgggccaccttctgccacttacggcctggcacaccc
tatcaggcccaagtggaggctcagctcccaccccaagggccctgggaaccaggctgggag
aggctggagcagcgggctgccaccctgcagttcaccacactcccagcaggcccacctgat
gcccctctggatgtgcagatcgagcctgggccctcccctgggatcttgatcatcagttgg
ctcccagtcaccatcgatgctgctggcacatccaacggtgtccgggtcacaggctatgcc
atctacgctgatgggcagaagatcatggaggtggcctcacccacggcaggcagtgtactg
gtggagttgtcccagctgcagctgctgcaggtgtgtcgtgaggtggtcgtgcgcaccatg
tcgccccacggggagtcggcggactccatcccggctcctatcactcccgccctggctccg
gccagcctgccagcccgagtctcctgcccctcaccgcacccaagcccagaggccagagcg
ccccttgcttcagcctccccagggcctggagaccccagctctcctctccagcaccctgct
ccccttggaactcaagagcctccaggagcaccccctgcaagcccttccagagagatggca
aaagggtcccacgaggaccctccagcaccttgctcccaggaggaggctggggcagcagtg
ctgggcacctcagaggagaggacagccagcacatctaccctgggtgagaaggaccctggc
cccgcagctccctcactggccaagcaggaggccgagtggactgcaggagaggcctgtccg
gcctccagctccacccagggagcacgggcccagcaggcgccaaataccgagatgtgccaa
ggaggagacccagggtctgggctgaggcccagggctgagaaggaggacacagcagagctt
ggggttcatctggtgaactccctcgtggaccacggccgcaactcagacctgtcagacatc
caggaggaagaggaagaggaggaggaggaggaggaagaggagctgggttccaggacttgc
tccttccagaagcaggttgctggcaacagcatcagggagaatggggccaagtcccagccc
gaccccttttgtgagactgacagcgatgaggagatcttggagcagatcctggagctgccc
ctccagcagttctgtagcaagaagctctttagcatcccggaggaggaggaagaggaagag
gaggacgaggaggaggagaagtcaggggcaggctgttcttcccgagaccctggcccgcct
gaacctgcattgctggggctgggctgtgacagtggtcagccccgaagacctggccagtgt
cccttgtctcctgagtcctccagggctggagactgcctggaagacatgcctggattagtt
ggtggaagcagccggaggagaggagggggctcccctgagaagcccccaagccgcaggcgg
cctccagatccccgagaacactgcagccgacttctcagcaacaatgggccccaggcctct
ggacgactgggccccacacgggagaggggtggcctccccgtaattgagggccccaggact
ggactagaggctagcgggagaggccggctgggcccttcccggaggtgctcccgtggccgg
gcgctggagcctggcctggccagctgcctttcccccaagtgcttggaaatcagcattgaa
tatgattcggaggatgagcaggaggcgggcagcgggggcatcagcatcaccagctcctgc
taccctggagatggggaggcctggggcacagcaactgtaggaaggcccagggggcctccg
aaggccaattcaggccccaagccctacccacgcctcccagcctgggagaaaggggaacca
gagcggagaggccgcagtgcgacgggcagagccaaggagccactctcccgggcaacagag
accggagaggccagagggcaggacggctctgggcggaggggcccccagaagagaggtgtc
cgagtcctcaggccaagcactgcagagctagtccctgcgaggagcccctcagaaacactg
gcttaccagcacctacccgtcaggatctttgtggctctgtttgactatgaccccgtgtca
atgtcgcccaatcctgatgctggagaagaagagcttcccttccgagagggtcagatcctg
aaggtgtttggggacaaggatgccgatggcttctaccagggcgaaggtgggggccggaca
ggctacattccctgcaacatggtggctgaggtggctgtggacagccctgctgggagacag
caactgctccagcggggttatttgtccccagatattctccttgagggctcagggaatggt
ccgtttgtgtactccacagcccacacaactgggcctcctcccaagccccgccgctccaag
aaagctgagtcggaaggccctgcccagccctgtccaggcccccctaagctggtcccctct
gctgacctgaaagctccccactccatggtggctgcatttgactacaacccccaggagagt
tcccccaatatggacgtggaggcagagctgcccttccgggcaggggatgtcattactgtg
tttgggggcatggacgatgacggtttctactatggggaattaaatggacaaaggggcctg
gttccatccaacttcctggagggccctgggcctgaggcaggcggcctggacagggaaccc
aggacaccccaggctgagagtcagagaacgaggaggagaagagtccagtgctag

DBGET integrated database retrieval system