KEGG   Homo sapiens (human): 92579Help
Entry
92579             CDS       T01001                                 

Gene name
G6PC3, SCN4, UGRP
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit 3
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00718  Glycogen degradation
Disease
H00939  Darsun syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    92579 (G6PC3)
   00052 Galactose metabolism
    92579 (G6PC3)
   00500 Starch and sucrose metabolism
    92579 (G6PC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    92579 (G6PC3)
   04151 PI3K-Akt signaling pathway
    92579 (G6PC3)
   04152 AMPK signaling pathway
    92579 (G6PC3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    92579 (G6PC3)
   04922 Glucagon signaling pathway
    92579 (G6PC3)
   04920 Adipocytokine signaling pathway
    92579 (G6PC3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    92579 (G6PC3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    92579 (G6PC3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     92579 (G6PC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 92579
NCBI-ProteinID: NP_612396
OMIM: 611045
HGNC: 24861
Ensembl: ENSG00000141349
Vega: OTTHUMG00000181805
Pharos: Q9BUM1(Tbio)
UniProt: Q9BUM1
Position
17q21.31
AA seq 346 aa AA seqDB search
MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWI
SLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGA
ALWPIMTALSSQVATRARSRWVRVMPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGA
VLGWLMTPRVPMERELSFYGLTALALMLGTSLIYWTLFTLGLDLSWSISLAFKWCERPEW
IHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWL
GHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagtccacgctgggcgcgggcatcgtgatagccgaggcgctacagaaccagctagcc
tggctggagaacgtgtggctctggatcacctttctgggcgatcccaagatcctctttctg
ttctacttccccgcggcctactacgcctcccgccgtgtgggcatcgcggtgctctggatc
agcctcatcaccgagtggctcaacctcatcttcaagtggtttctttttggagacaggccc
ttttggtgggtccatgagtctggttactacagccaggctccagcccaggttcaccagttc
ccctcttcttgtgagactggtccaggcagcccttctggacactgcatgatcacaggagca
gccctctggcccataatgacggccctgtcttcgcaggtggccactcgggcccgcagccgc
tgggtaagggtgatgcctagcctggcttattgcaccttccttttggcggttggcttgtcg
cgaatcttcatcttagcacatttccctcaccaggtgctggctggcctaataactggcgct
gtcctgggctggctgatgactccccgagtgcctatggagcgggagctaagcttctatggg
ttgactgcactggccctcatgctaggcaccagcctcatctattggaccctctttacactg
ggcctggatctttcttggtccatcagcctagccttcaagtggtgtgagcggcctgagtgg
atacacgtggatagccggccctttgcctccctgagccgtgactcaggggctgccctgggc
ctgggcattgccttgcactctccctgctatgcccaggtgcgtcgggcacagctgggaaat
ggccagaagatagcctgccttgtgctggccatggggctgctgggccccctggactggctg
ggccacccccctcagatcagcctcttctacattttcaatttcctcaagtacaccctctgg
ccatgcctagtcctggccctcgtgccctgggcagtgcacatgttcagtgcccaggaagca
ccgcccatccactcttcctga

DBGET integrated database retrieval system