KEGG   Homo sapiens (human): 926Help
Entry
926               CDS       T01001                                 

Gene name
CD8B, CD8B1, LEU2, LY3, LYT3, P37
Definition
(RefSeq) CD8b molecule
  KO
K06459  T-cell surface glycoprotein CD8 beta chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04660  T cell receptor signaling pathway
hsa05340  Primary immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    926 (CD8B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    926 (CD8B)
   04612 Antigen processing and presentation
    926 (CD8B)
   04660 T cell receptor signaling pathway
    926 (CD8B)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    926 (CD8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    926 (CD8B)
CD molecules [BR:hsa04090]
 Proteins
  926 (CD8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 Herpes_gE Ig_6
Motif
Other DBs
NCBI-GeneID: 926
NCBI-ProteinID: NP_004922
OMIM: 186730
HGNC: 1707
Ensembl: ENSG00000172116
Vega: OTTHUMG00000130264
Pharos: P10966(Tbio)
UniProt: P10966
Position
2p11.2
AA seq 210 aa AA seqDB search
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQA
PSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG
SPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGV
LVLLVSLGVAIHLCCRRRRARLRFMKQFYK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcggctgtggctcctcttggccgcgcagctgacagttctccatggcaactca
gtcctccagcagacccctgcatacataaaggtgcaaaccaacaagatggtgatgctgtcc
tgcgaggctaaaatctccctcagtaacatgcgcatctactggctgagacagcgccaggca
ccgagcagtgacagtcaccacgagttcctggccctctgggattccgcaaaagggactatc
cacggtgaagaggtggaacaggagaagatagctgtgtttcgggatgcaagccggttcatt
ctcaatctcacaagcgtgaagccggaagacagtggcatctacttctgcatgatcgtcggg
agccccgagctgaccttcgggaagggaactcagctgagtgtggttgatttccttcccacc
actgcccagcccaccaagaagtccaccctcaagaagagagtgtgccggttacccaggcca
gagacccagaagggcccactttgtagccccatcacccttggcctgctggtggctggcgtc
ctggttctgctggtttccctgggagtggccatccacctgtgctgccggcggaggagagcc
cggcttcgtttcatgaaacaattttacaaatga

DBGET integrated database retrieval system